DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14968 and Nos1ap

DIOPT Version :10

Sequence 1:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001103455.1 Gene:Nos1ap / 70729 MGIID:1917979 Length:503 Species:Mus musculus


Alignment Length:187 Identity:46/187 - (24%)
Similarity:80/187 - (42%) Gaps:49/187 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DLDSQVNVEDL---PITFKVKYIGS----------EVARGLWGIKYTRRPVDIMVGVAKNLPPNK 61
            ||...::.||.   .|:|:.||:||          |:...:..|:|..:        |||:...|
Mouse    15 DLRIPLHNEDAFQHGISFEAKYVGSLDVPRPNSRVEIVAAMRRIRYEFK--------AKNIKKKK 71

  Fly    62 VLPNCELKVSTDGVQLEIISPKASINHWS-------------YPIDTISYGVQDLVYTRVFAMIV 113
            |    .:.||.|||:: |:..|.....|:             |.|..:|:..|||   ::|:.| 
Mouse    72 V----SIMVSVDGVKV-ILKKKKKKKEWTWDESKMLVMQDPIYRIFYVSHDSQDL---KIFSYI- 127

  Fly   114 VKDESSPHPFEVHAFVCDSRAMARKLTFALAAAFQ-----DYSRRVKEATGEEEGEA 165
            .:|.:| :.|..:.|....::.|.::...:..||:     ......:.|.|:|:||:
Mouse   128 ARDGAS-NIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGES 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982 34/146 (23%)
Nos1apNP_001103455.1 PTB_CAPON-like 2..180 CDD:269968 43/182 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..212 5/14 (36%)
Interaction with NOS1. /evidence=ECO:0000250 491..503
PDZ-binding. /evidence=ECO:0000250 501..503
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.