DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14968 and APPL2

DIOPT Version :9

Sequence 1:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001238833.1 Gene:APPL2 / 55198 HGNCID:18242 Length:670 Species:Homo sapiens


Alignment Length:147 Identity:22/147 - (14%)
Similarity:59/147 - (40%) Gaps:14/147 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNNSSTTDLDSQVNVED--LPITFKVKYIGSEVARGLWGIKYTRRPVDIMVGVAKNLPPNKVLPN 65
            :|....|:.:|....||  |...|.|:::||...:       |....:::....:.:...:.:.|
Human   477 TNPFGETEDESFPEAEDSLLQQMFIVRFLGSMAVK-------TDSTTEVIYEAMRQVLAARAIHN 534

  Fly    66 ----CELKVSTDGVQLEIISPKASINHWSYPIDTISYGVQDLVYTRVFAMIVVKDESSPHPFEVH 126
                .|..:......|.:|.|:..::..::.:.:::.........|:...::...||:... .:.
Human   535 IFRMTESHLMVTSQSLRLIDPQTQVSRANFELTSVTQFAAHQENKRLVGFVIRVPESTGEE-SLS 598

  Fly   127 AFVCDSRAMARKLTFAL 143
            .::.:|.:...|:.:|:
Human   599 TYIFESNSEGEKICYAI 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982 16/125 (13%)
APPL2NP_001238833.1 BAR_APPL2 20..240 CDD:153316
BAR-PH_APPL 258..382 CDD:270067
PTB_APPL 488..621 CDD:269980 19/136 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 649..670
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.