DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14968 and ldlrap1

DIOPT Version :9

Sequence 1:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001017114.1 Gene:ldlrap1 / 549868 XenbaseID:XB-GENE-954261 Length:309 Species:Xenopus tropicalis


Alignment Length:180 Identity:50/180 - (27%)
Similarity:79/180 - (43%) Gaps:20/180 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ITFKVKYIGSEVARGLWGIKYTRRPVDIMVGVAKNLPPNKVLPNCELKVSTDGVQLEIISPKASI 86
            ::|.:||:|..:.....|.:.:...|..:|..||  ...|.|....||||..|:.|..::....|
 Frog    45 MSFHLKYLGMTLVEQPKGEELSATAVKRIVATAK--ASGKKLQKVILKVSPRGIILYDLASNQLI 107

  Fly    87 NHWSYPIDTISYGVQDLVYTRVFAMIVVKDESSPHPFEVHAFVCDSRAMARKLTFALAAAFQ--- 148
            .:.|  |..|||...|.::.:|||.|....::  ...|.|||:|..|.||:.:|..:|.||:   
 Frog   108 ENVS--IYRISYCTADKMHDKVFAYIAQSQQN--ETLECHAFLCTKRKMAQAVTLTVAQAFKVAF 168

  Fly   149 ---DYSRRVKE--------ATGEEEGEATPSDTITPTRHKFAIDLRTPEE 187
               ..||..||        ..|....::..|.:||..:...:.:|...|:
 Frog   169 EFWQVSRENKEKREKSGSDGEGASSSQSDGSSSITSLKASASANLLDLED 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982 38/123 (31%)
ldlrap1NP_001017114.1 PTB_LDLRAP-mammal-like 43..165 CDD:269981 39/125 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.