DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14968 and Ldlrap1

DIOPT Version :9

Sequence 1:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001102741.1 Gene:Ldlrap1 / 500564 RGDID:1563417 Length:307 Species:Rattus norvegicus


Alignment Length:180 Identity:51/180 - (28%)
Similarity:75/180 - (41%) Gaps:21/180 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ITFKVKYIGSEVARGLWGIKYTRRPVDIMVGVAKNLPPNKVLPNCELKVSTDGVQLEIISPKASI 86
            :.|.:||:|..:.....|.:.:...|..:|..||  ...|.|....||||..|:.|........|
  Rat    45 MVFSLKYLGMTLVERPKGEELSAAAVKRIVATAK--ASGKKLQKVTLKVSPRGIILTDSLTSQLI 107

  Fly    87 NHWSYPIDTISYGVQDLVYTRVFAMIVVKDESSPHPFEVHAFVCDSRAMARKLTFALAAAFQ--- 148
            .:.|  |..|||...|.::.:|||.|....::  ...|.|||:|..|.:|:.:|..:|.||:   
  Rat   108 ENVS--IYRISYCTADKMHDKVFAYIAQSQQN--ESLECHAFLCTKRKVAQAVTLTVAQAFKVAF 168

  Fly   149 ---DYSRRVKE--ATGEEEGEATPSDTITPTRHKFAIDLRTPEEIQAGEL 193
               ..|:..||  ....:||...|.     ||......|:|  .:..|.|
  Rat   169 EFWQVSKEEKEKREKANQEGGDVPG-----TRRDSTPSLKT--SVATGNL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982 37/123 (30%)
Ldlrap1NP_001102741.1 PTB_LDLRAP-mammal-like 43..165 CDD:269981 38/125 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..205 8/32 (25%)
Clathrin box. /evidence=ECO:0000250|UniProtKB:Q5SW96 211..215 1/1 (100%)
AP-2 complex binding. /evidence=ECO:0000250|UniProtKB:Q5SW96 248..275
[DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif. /evidence=ECO:0000250|UniProtKB:Q5SW96 256..265
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I5404
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.