DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14968 and Dab

DIOPT Version :9

Sequence 1:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001163455.2 Gene:Dab / 39866 FlyBaseID:FBgn0000414 Length:2360 Species:Drosophila melanogaster


Alignment Length:137 Identity:37/137 - (27%)
Similarity:54/137 - (39%) Gaps:29/137 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ITFKVKYIG-SEV--ARG-------LWGIKYTRRPVDIMVGVAKNLPPNKVLPNCELKVSTDGVQ 76
            :.||.|.|| .||  |||       |..:|...|    ..|..|.        ...:.|:.||::
  Fly    49 VQFKAKLIGILEVGEARGDRMCQEALQDLKMAIR----AAGEHKQ--------RITIHVTIDGLR 101

  Fly    77 LEIISPKASINHWSYPIDTISYGVQDLVYTRVFAMIVVKDESSPHPFEVHAFVCDSRAMARKLTF 141
            |.......|:.|  :|:..||:..||:..:|.|..|....:|. |.|    |...:...|.::..
  Fly   102 LRDEKTGDSLYH--HPVHKISFIAQDMTDSRAFGYIFGSPDSG-HRF----FGIKTDKAASQVVL 159

  Fly   142 ALAAAFQ 148
            |:...||
  Fly   160 AMRDLFQ 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982 35/133 (26%)
DabNP_001163455.2 PTB_Dab 35..181 CDD:269926 37/137 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11232
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.