DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14968 and CG42673

DIOPT Version :9

Sequence 1:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_729510.1 Gene:CG42673 / 39111 FlyBaseID:FBgn0261555 Length:904 Species:Drosophila melanogaster


Alignment Length:43 Identity:14/43 - (32%)
Similarity:19/43 - (44%) Gaps:6/43 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 GEATPSDTITPTRHKFA------IDLRTPEEIQAGELEQETEA 199
            |..|||...|..|:.||      .|:|...|.....||::.:|
  Fly   739 GTLTPSPLGTMNRNSFAGSSSLNEDIRLSIEQNLNNLEEQLKA 781

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982
CG42673NP_729510.1 PH-like <352..386 CDD:302622
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11232
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.