DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14968 and Appl2

DIOPT Version :9

Sequence 1:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001102211.1 Gene:Appl2 / 362860 RGDID:1563028 Length:662 Species:Rattus norvegicus


Alignment Length:218 Identity:45/218 - (20%)
Similarity:69/218 - (31%) Gaps:85/218 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 VDIMVGVAKNLPPNKVLPNCELKVSTDGVQLEIISPKAS----------INHW------SYPIDT 95
            |.|:...|.::|..:     ||......:|.:|:.|...          ||.:      |:| |.
  Rat   425 VKIVPKAAASIPETE-----ELIAPGTPIQFDIVLPATEFLDQNRGSRRINPFGETEDDSFP-DA 483

  Fly    96 ISYGVQDLVYTRVFAMIVVKDESSPHPF--------------------EVHAFV-------CDSR 133
            ....:|.:...|....:.||.:|:....                    |.|..|       .|.:
  Rat   484 EDSLLQQMFIVRFLGSMAVKTDSTTEVIYEAMRQVLAARAIHNIFRTTESHLMVTSQTLRLIDPQ 548

  Fly   134 AMARKLTFALA-----AAFQDYSR------RVKEATGEE-----------EGEATPSDTITPTRH 176
            ....:..|.|.     ||.|:..|      ||.|:||||           |||            
  Rat   549 TQVSRACFELTSVTQFAAHQENKRLVGFVIRVPESTGEESLSTYIFESNSEGE------------ 601

  Fly   177 KFAIDLRTPEEIQAGELEQETEA 199
            |....:...:||.  |::::.||
  Rat   602 KICYAINLGKEII--EVQKDPEA 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982 26/147 (18%)
Appl2NP_001102211.1 BAR_APPL2 20..234 CDD:153316
BAR-PH_APPL 252..376 CDD:270067
PTB_APPL 480..613 CDD:269980 28/145 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 643..662
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.