DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14968 and numb

DIOPT Version :9

Sequence 1:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001260291.1 Gene:numb / 34263 FlyBaseID:FBgn0002973 Length:556 Species:Drosophila melanogaster


Alignment Length:198 Identity:49/198 - (24%)
Similarity:73/198 - (36%) Gaps:58/198 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VEDLPITFKVKYIGS-EV--ARGLW----GIKY----TRRPVDIMVGVAKNLPPNKVLPNCELKV 70
            |.....:|.|||:|. ||  :||:.    .:|.    .||||       :.|          |.|
  Fly    76 VRSATCSFSVKYLGCVEVFESRGMQVCEEALKVLRQSRRRPV-------RGL----------LHV 123

  Fly    71 STDGVQLEIISPKASINHWSYPIDTISYGVQDLVYTRVFAMIVVKDESSPHPFEVHAFVC--DSR 133
            |.||:::.....|..|  ....|:.:|:...|..:.|.|:.|.  .:.:...:..|.|:.  || 
  Fly   124 SGDGLRVVDDETKGLI--VDQTIEKVSFCAPDRNHERGFSYIC--RDGTTRRWMCHGFLACKDS- 183

  Fly   134 AMARKLTFALAAAF----QDYSRRVKEATGEEEGEATPSDTITPTRHKFAIDLRTPEEIQAGELE 194
              ..:|:.|:..||    :...||.||. |......|.:.|.|.|                |...
  Fly   184 --GERLSHAVGCAFAVCLERKQRRDKEC-GVTMTFDTKNSTFTRT----------------GSFR 229

  Fly   195 QET 197
            |:|
  Fly   230 QQT 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982 34/136 (25%)
numbNP_001260291.1 PTB_Numb 67..201 CDD:241298 37/148 (25%)
NumbF 269..374 CDD:283874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11232
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.