DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14968 and LDLRAP1

DIOPT Version :9

Sequence 1:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_056442.2 Gene:LDLRAP1 / 26119 HGNCID:18640 Length:308 Species:Homo sapiens


Alignment Length:163 Identity:49/163 - (30%)
Similarity:69/163 - (42%) Gaps:26/163 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FKVKYIGSEVARGLWGIKYTRRPVDIMVGVAKNLPPNKVLPNCELKVSTDGVQLEIISPKASINH 88
            |.:||:|..:.....|.:.:...:..:|..||  ...|.|....||||..|:.|........|.:
Human    48 FSLKYLGMTLVEQPKGEELSAAAIKRIVATAK--ASGKKLQKVTLKVSPRGIILTDNLTNQLIEN 110

  Fly    89 WSYPIDTISYGVQDLVYTRVFAMIVVKDESSPH--PFEVHAFVCDSRAMARKLTFALAAAFQ--- 148
            .|  |..|||...|.::.:|||.|.    .|.|  ..|.|||:|..|.||:.:|..:|.||:   
Human   111 VS--IYRISYCTADKMHDKVFAYIA----QSQHNQSLECHAFLCTKRKMAQAVTLTVAQAFKVAF 169

  Fly   149 ---DYSRRVKEA--TGEEEG--------EATPS 168
               ..|:..||.  ...:||        :.|||
Human   170 EFWQVSKEEKEKRDKASQEGGDVLGARQDCTPS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982 39/124 (31%)
LDLRAP1NP_056442.2 PTB_LDLRAP-mammal-like 44..166 CDD:269981 40/125 (32%)
Clathrin box. /evidence=ECO:0000269|PubMed:12221107 212..216
AP-2 complex binding. /evidence=ECO:0000269|PubMed:12221107 249..276
[DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif. /evidence=ECO:0000269|PubMed:16516836 257..266
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.