DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14968 and MAPK8IP2

DIOPT Version :10

Sequence 1:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_011528981.1 Gene:MAPK8IP2 / 23542 HGNCID:6883 Length:825 Species:Homo sapiens


Alignment Length:62 Identity:14/62 - (22%)
Similarity:26/62 - (41%) Gaps:7/62 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 EKSATKEVMSIL--GKYIGSMHEEKPEVLNSTASKKQKVCAQETEEGGEKTVPLENDALQET 131
            |:...::|..:|  |.|.|:..:     |.|..||.:::.......|....:.:....||:|
Human   258 EEQIQEQVKQLLSNGGYYGASQQ-----LRSMFSKVREMLRMRDSNGARMLILMTEQFLQDT 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982 14/62 (23%)
MAPK8IP2XP_011528981.1 SH3_JIP2 609..663 CDD:212875
PTB_JIP 680..825 CDD:269923
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.