DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14968 and ced-6

DIOPT Version :9

Sequence 1:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_498203.2 Gene:ced-6 / 175773 WormBaseID:WBGene00000420 Length:492 Species:Caenorhabditis elegans


Alignment Length:147 Identity:36/147 - (24%)
Similarity:65/147 - (44%) Gaps:24/147 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VNVEDLPITFKVKYI-------------GSEVAR-GLWGIKYTRRPVDIMVGVAKNLPPNKVLPN 65
            ::..|..|...|:|:             ||:||| .:..|::.|   |:.  .::.......|..
 Worm    48 IHPPDYLINGHVEYVARFLGCVETPKANGSDVAREAIHAIRFQR---DLK--RSEQTRETAKLQK 107

  Fly    66 CELKVSTDGVQLEIISPKASINHWSYPIDTISYGVQDLVYTRVFAMIVVKDESSPHPFEVHAFVC 130
            .|:::|.|.|.:..|..||.:  :::|:..||:...|....|:|:.|...:.:|..| ..:||. 
 Worm   108 VEIRISIDNVIIADIKTKAPM--YTFPLGRISFCADDKDDKRMFSFIARAEGASGKP-SCYAFT- 168

  Fly   131 DSRAMARKLTFALAAAF 147
             |..:|..:|..:..||
 Worm   169 -SEKLAEDITLTIGEAF 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982 32/137 (23%)
ced-6NP_498203.2 PTB_CED-6 48..196 CDD:269971 36/147 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3536
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.