DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12009 and mtg

DIOPT Version :9

Sequence 1:NP_647799.1 Gene:CG12009 / 38405 FlyBaseID:FBgn0035430 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_731221.2 Gene:mtg / 40970 FlyBaseID:FBgn0260386 Length:556 Species:Drosophila melanogaster


Alignment Length:245 Identity:56/245 - (22%)
Similarity:86/245 - (35%) Gaps:56/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HQKRKAPVTREEPV-PAEVEMPEQTETEDEEAPAEAASMG------TLTLPSNATSIRSD--ITD 78
            |:.:.|...|||.: .:.|.....|.|.....|....|:.      .:..|.....:..|  ..|
  Fly   322 HRAQLAAKLREEFMRTSTVRTTTTTTTTTTTTPRPQKSLAEHKVSKVMNAPKEYYPVGYDKNFDD 386

  Fly    79 N-----------FSCVNKTY--GYYADVENDCQIFHVCLPVTYADGRENTFRWSFICPEETIFSQ 130
            |           |||..:.:  |.|||.:..|.:||||     |...:...|.||:|||.|:|.|
  Fly   387 NFKSKVDLPPTSFSCAKQKHFPGLYADTDLGCMVFHVC-----ALTDDGMVRKSFLCPENTLFDQ 446

  Fly   131 ESFTCMRREDMTIECEDSSRYYELN----------------GNFGGPAEEESKPTPVESEEPEKE 179
            ....|  .....::|..|:..|:.|                ..:.|....|        :..:|:
  Fly   447 TILKC--NWWFYVDCSSSTSVYDSNIPISKSYQLMKSLTYFSKYAGGQRHE--------QGGDKD 501

  Fly   180 ESEPEPEPVESEPEIPAEPEVQTAKPMKPVKAQKPKPNRRKPQPQRKVPA 229
            |:..:.:.:....|..|..:.|..|....|:.|:..|   |...:..|||
  Fly   502 ENALDIDSLRESMEGVARRQEQAKKAELRVEEQRSMP---KEDHEHVVPA 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12009NP_647799.1 CBM_14 82..145 CDD:279884 21/64 (33%)
mtgNP_731221.2 CBM_14 409..459 CDD:279884 20/56 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.