DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12009 and CG14607

DIOPT Version :9

Sequence 1:NP_647799.1 Gene:CG12009 / 38405 FlyBaseID:FBgn0035430 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_649709.2 Gene:CG14607 / 40869 FlyBaseID:FBgn0037488 Length:401 Species:Drosophila melanogaster


Alignment Length:212 Identity:54/212 - (25%)
Similarity:74/212 - (34%) Gaps:75/212 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 NFSCVNKTY-GYYADVENDCQIFHVC-LPVTYADGRENTFRWSFICPEETIFSQESFTCM----- 136
            ||.|..:.. |||||:|..||:||:| |..||          ||:||..|:||||:..|:     
  Fly   187 NFDCAQQPLPGYYADIEAQCQVFHICALNRTY----------SFLCPNGTVFSQETLVCVWWNQY 241

  Fly   137 -------------------RREDMTIECEDSSRYY----ELNGNFGGP--------AEEESKPTP 170
                               .|....:...:::..|    ..:..||.|        |...|:...
  Fly   242 DCVSAPSLYANNAYIYDYSERSGSNLRTSNTNNVYRPAASSSAAFGAPLATTGTLRATGVSQVAG 306

  Fly   171 VESEEPEKEESEPEPEPVESEPEIPAEPEVQTAKPMKPVKA---QKPK--PN---RRKPQPQRKV 227
            ..|.......:.|.|                ||:|..|..|   .:|.  |:   .|.|.....|
  Fly   307 YNSGRGSYPSATPTP----------------TAQPQSPYGAGAVLRPAIVPSTGANRLPPSGAAV 355

  Fly   228 PAVVTAAPEVEAIPEPS 244
            ..:.|||   .|:||.|
  Fly   356 GLLATAA---GALPESS 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12009NP_647799.1 CBM_14 82..145 CDD:279884 26/88 (30%)
CG14607NP_649709.2 CBM_14 190..243 CDD:279884 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.