DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12009 and CG13675

DIOPT Version :9

Sequence 1:NP_647799.1 Gene:CG12009 / 38405 FlyBaseID:FBgn0035430 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_001261563.1 Gene:CG13675 / 38907 FlyBaseID:FBgn0035845 Length:355 Species:Drosophila melanogaster


Alignment Length:216 Identity:41/216 - (18%)
Similarity:72/216 - (33%) Gaps:87/216 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WKTLCLLL-------LLTATCSAGPLSAHQKRKAPVTREEPVPAEVEMPEQTETEDEEAPAEAAS 59
            | :.|:::       :|...|..|.:..:                        |..|:.||..| 
  Fly    25 W-SACIMIVVFGLFSMLAGNCVNGQIDGY------------------------TAGEDYPAYDA- 63

  Fly    60 MGTLTLPSNATSIRSDITDNFSCVNKTYGYYADVENDCQIFHVCLPVTYADGRENTFRWSFICPE 124
                 :|....         |:|..:..|||||.|..||::|.||        .:..::||:||.
  Fly    64 -----VPKGLA---------FNCQGRQPGYYADTETRCQVWHWCL--------HSGHQYSFLCPN 106

  Fly   125 ETIFSQESFTCMRRED--MTIECEDSSRYYELN--------------------------GNFGGP 161
            .|:|:|....|    |  ..:.||.|.:.|:.|                          |...|.
  Fly   107 GTVFNQAVRVC----DWWSNVNCEGSEQLYQNNDELYRIPERQQQLNDVXYEADDEYKIGTANGT 167

  Fly   162 AEEESKPTPVESEEPEKEESE 182
            .:...:....:.::.:|::.:
  Fly   168 RQRGGRQRQFQKQQQQKQQQQ 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12009NP_647799.1 CBM_14 82..145 CDD:279884 21/64 (33%)
CG13675NP_001261563.1 CBM_14 72..125 CDD:279884 21/64 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.