powered by:
Protein Alignment ckd and CG14301
DIOPT Version :9
Sequence 1: | NP_647796.2 |
Gene: | ckd / 38402 |
FlyBaseID: | FBgn0035427 |
Length: | 140 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_650734.2 |
Gene: | CG14301 / 42235 |
FlyBaseID: | FBgn0038632 |
Length: | 196 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 29/72 - (40%) |
Similarity: | 41/72 - (56%) |
Gaps: | 1/72 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 SFDCKRRSV-GFYADMEYNCQIFHMCDEEGNRIPHLCANETSFNQEYRICDWDYNFNCTESPKWF 121
:|.|..:.. ||:||||..||.:|.||.:|.:...||.|.|.|:|...:|||.:|..|..||:.:
Fly 101 NFYCDEQEYPGFFADMETRCQGWHYCDIDGRQATFLCPNGTQFSQAVFVCDWWFNVRCDLSPRLY 165
Fly 122 YLNELTY 128
.:|...|
Fly 166 AINARLY 172
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR22933 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.