DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ckd and CG14301

DIOPT Version :9

Sequence 1:NP_647796.2 Gene:ckd / 38402 FlyBaseID:FBgn0035427 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_650734.2 Gene:CG14301 / 42235 FlyBaseID:FBgn0038632 Length:196 Species:Drosophila melanogaster


Alignment Length:72 Identity:29/72 - (40%)
Similarity:41/72 - (56%) Gaps:1/72 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SFDCKRRSV-GFYADMEYNCQIFHMCDEEGNRIPHLCANETSFNQEYRICDWDYNFNCTESPKWF 121
            :|.|..:.. ||:||||..||.:|.||.:|.:...||.|.|.|:|...:|||.:|..|..||:.:
  Fly   101 NFYCDEQEYPGFFADMETRCQGWHYCDIDGRQATFLCPNGTQFSQAVFVCDWWFNVRCDLSPRLY 165

  Fly   122 YLNELTY 128
            .:|...|
  Fly   166 AINARLY 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ckdNP_647796.2 CBM_14 61..111 CDD:279884 22/50 (44%)
CG14301NP_650734.2 CBM_14 104..156 CDD:279884 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.