DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ckd and mtg

DIOPT Version :9

Sequence 1:NP_647796.2 Gene:ckd / 38402 FlyBaseID:FBgn0035427 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_731221.2 Gene:mtg / 40970 FlyBaseID:FBgn0260386 Length:556 Species:Drosophila melanogaster


Alignment Length:102 Identity:29/102 - (28%)
Similarity:44/102 - (43%) Gaps:20/102 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NHKTKEWTNLDNITFSFDCKRRS--VGFYADMEYNCQIFHMC---DEEGNRIPHLCANETSFNQE 102
            |.|:|    :|....||.|.::.  .|.|||.:..|.:||:|   |:...|...||...|.|:|.
  Fly   387 NFKSK----VDLPPTSFSCAKQKHFPGLYADTDLGCMVFHVCALTDDGMVRKSFLCPENTLFDQT 447

  Fly   103 YRICDWDYNFNCTESPKWF-----------YLNELTY 128
            ...|:|.:..:|:.|...:           .:..|||
  Fly   448 ILKCNWWFYVDCSSSTSVYDSNIPISKSYQLMKSLTY 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ckdNP_647796.2 CBM_14 61..111 CDD:279884 18/54 (33%)
mtgNP_731221.2 CBM_14 409..459 CDD:279884 17/49 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.