DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12078 and Ublcp1

DIOPT Version :10

Sequence 1:NP_647795.2 Gene:CG12078 / 38401 FlyBaseID:FBgn0035426 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_077795.2 Gene:Ublcp1 / 79560 MGIID:1933105 Length:318 Species:Mus musculus


Alignment Length:225 Identity:44/225 - (19%)
Similarity:81/225 - (36%) Gaps:63/225 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LEKVYRVFVEYTPIIYLSEDRLSPVSKSRLSLVARKTLVLDMDNTMITSWFIKRGKKPKNIPRIA 100
            |.||.|...||      ..:.|:|..:      .:|.||||:|.|:    |..|......:..: 
Mouse   115 LLKVSRRVKEY------KVEVLNPPRE------GKKLLVLDVDYTL----FDHRSCAETGVELM- 162

  Fly   101 HDFKFYLPAYGATIYVYKRPYLDHFLDRVSKWYDLTVFTS-------------GAEIYASPILDF 152
                              ||||..||....:.||:.::::             |....|:..:.|
Mouse   163 ------------------RPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITF 209

  Fly   153 LDRGRGILNSRLYRQHCIEQ------FGKWSKSVLLACPDLSNVVLLDNSSTECSFNAENAILI- 210
            :.....::.....|:..|:.      :||:|:..     ...|.::.|:.......|.:|.:.| 
Mouse   210 MLDSAAMITVHTPRRGLIDVKPLGVIWGKFSEFY-----SKKNTIMFDDIGRNFLMNPQNGLKIR 269

  Fly   211 ---KSYEIGCRDEALINLLPFLDALRFMKD 237
               |::....:|:.|:.|..:|..:..:.|
Mouse   270 PFMKAHLNRDKDKELVKLTQYLKEIAKLDD 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12078NP_647795.2 HIF-SF_euk 70..237 CDD:274055 35/189 (19%)
Ublcp1NP_077795.2 Ubl_UBLCP1 3..77 CDD:340511
HAD_IIID1 117..311 CDD:131299 43/223 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.