DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12078 and Fcp1

DIOPT Version :10

Sequence 1:NP_647795.2 Gene:CG12078 / 38401 FlyBaseID:FBgn0035426 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_611934.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster


Alignment Length:155 Identity:48/155 - (30%)
Similarity:72/155 - (46%) Gaps:12/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SRLSLVARK-TLVLDMDNTMITSWFIKRGKKPKNIPRIAHDFKFYLPAYGATIYVYKRPYLDHFL 126
            :|..|..|| .|::|:|.|:|.:   .....|.||..|.| |:.|.| :....:...||....||
  Fly   199 TRRLLADRKLVLLVDLDQTVIHT---TNDTVPDNIKGIYH-FQLYGP-HSPWYHTRLRPGTAEFL 258

  Fly   127 DRVSKWYDLTVFTSGAEIYASPILDFLD-RGRGILNSRLYRQHCIEQFGKWSKSVLLAC--PDLS 188
            :|:|:.|:|.:.|.||..||..|...|| .|:...:..|.|..|   |...||:..|..  |:..
  Fly   259 ERMSQLYELHICTFGARNYAHMIAQLLDPEGKFFSHRILSRDEC---FNATSKTDNLKALFPNGD 320

  Fly   189 NVVLLDNSSTECSFNAENAILIKSY 213
            ::|.:.:...:....|.|.|.:|.|
  Fly   321 SMVCIIDDREDVWNMASNLIQVKPY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12078NP_647795.2 HIF-SF_euk 70..237 CDD:274055 46/148 (31%)
Fcp1NP_611934.1 Biotinyl_lipoyl_domains 59..142 CDD:448245
FCP1_euk 202..348 CDD:131304 47/152 (31%)
PRK08581 373..>530 CDD:236304
BRCT_CTDP1 578..674 CDD:349361
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.