DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and PPM1F

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_055449.1 Gene:PPM1F / 9647 HGNCID:19388 Length:454 Species:Homo sapiens


Alignment Length:344 Identity:106/344 - (30%)
Similarity:162/344 - (47%) Gaps:49/344 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PVTAKESAYCQNAAYRVGSSCMQGWRINMEDSH------THILSLPDDPGAAFFAVYDGHGGATV 66
            |:.|:.|    ...:.|....::..|..|||.|      ..:..|.|....|:|||:|||||...
Human   145 PLAARAS----QRQWLVSIHAIRNTRRKMEDRHVSLPSFNQLFGLSDPVNRAYFAVFDGHGGVDA 205

  Fly    67 AQYAGKHLHKYVLKRPEYNDNIEQALQQGFLDIDYVMLRNKTCGDQMAGSTAVVVLVKDNKLYCA 131
            |:||..|:|....::||...:.|.||::.|...|.:.||........:|:|.|..|:....|:.|
Human   206 ARYAAVHVHTNAARQPELPTDPEGALREAFRRTDQMFLRKAKRERLQSGTTGVCALIAGATLHVA 270

  Fly   132 NAGDSRAIACVNGQLEVLSLDHKPNNEAESKRIIQGGGWVEFN---RVNGNLALSRALGDYVFKH 193
            ..|||:.|....||:..|...|:|..:.|..||...||:|...   ||||.||:|||:|| ||  
Human   271 WLGDSQVILVQQGQVVKLMEPHRPERQDEKARIEALGGFVSHMDCWRVNGTLAVSRAIGD-VF-- 332

  Fly   194 ENKKPEDQIVTAFPDVETRKIMDDWEFIVLACDGIWDVMSNAEVLEFCRTRI----GMGMFPEEI 254
              :||   .|:...|..:|.:....::::|||||.:||:.:.||:...::.:    |.|:   .:
Human   333 --QKP---YVSGEADAASRALTGSEDYLLLACDGFFDVVPHQEVVGLVQSHLTRQQGSGL---RV 389

  Fly   255 CEELMNHCLAPDCQMGGLGGDNMTVVLVCLLHGRPYSDLIARCRNGSQATNNDQEEAGDATKDEV 319
            .|||    :|...:.|  ..||:||::|.|   |...:|:   ..|:|...:.|.|         
Human   390 AEEL----VAAARERG--SHDNITVMVVFL---RDPQELL---EGGNQGEGDPQAE--------- 433

  Fly   320 AKDEAEAETDTETETQTKP 338
            .:.:....:..|.|||..|
Human   434 GRRQDLPSSLPEPETQAPP 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 91/274 (33%)
PPM1FNP_055449.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
PP2C 155..406 CDD:278884 87/267 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..454 10/46 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144750
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.