DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and PTC7

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_011943.2 Gene:PTC7 / 856475 SGDID:S000001118 Length:343 Species:Saccharomyces cerevisiae


Alignment Length:268 Identity:55/268 - (20%)
Similarity:101/268 - (37%) Gaps:70/268 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FFAVYDGHGGATVAQYAGKHLHKYVLKRPEYNDNIEQALQQG-----------FLDIDYVMLRNK 107
            |..|.||.||.....|....:.:.:.|:   .|.|..||.:.           .:...|..:|::
Yeast   104 FAGVADGVGGWAEHGYDSSAISRELCKK---MDEISTALAENSSKETLLTPKKIIGAAYAKIRDE 165

  Fly   108 TCGDQMAGSTAVVVLVKDN-KLYCANAGDSRAIACVNGQLEVLSLDHKPNNEAESKRIIQGGGWV 171
            .. .::.|:||:|.....| ||..||.|||..     |...            :||.:.|    .
Yeast   166 KV-VKVGGTTAIVAHFPSNGKLEVANLGDSWC-----GVFR------------DSKLVFQ----T 208

  Fly   172 EFNRVNGNLALSRA-LGDYVFKHENKKPEDQIVTAFPDVETRKIMDDWEF-------IVLACDGI 228
            :|..|..|.....: :.:.:.|...::....|      :.|.:..|::.|       |:||.||:
Yeast   209 KFQTVGFNAPYQLSIIPEEMLKEAERRGSKYI------LNTPRDADEYSFQLKKKDIIILATDGV 267

  Fly   229 WDVMSNAEVLEF-----CRTRIGMGMFPEEICEELMNHCLAPDC------QMGGLGG-------- 274
            .|.::..::..|     .||...:.:..::..:.:::....|:.      ::..|.|        
Yeast   268 TDNIATDDIELFLKDNAARTNDELQLLSQKFVDNVVSLSKDPNYPSVFAQEISKLTGKNYSGGKE 332

  Fly   275 DNMTVVLV 282
            |::|||:|
Yeast   333 DDITVVVV 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 55/268 (21%)
PTC7NP_011943.2 PTC1 50..343 CDD:223704 55/268 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.