DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and PTC5

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_014733.1 Gene:PTC5 / 854257 SGDID:S000005616 Length:572 Species:Saccharomyces cerevisiae


Alignment Length:277 Identity:72/277 - (25%)
Similarity:122/277 - (44%) Gaps:81/277 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MEDSHT-HILSLP--DDPGAA------FFAVYDGHGGATVAQYAGKHLHKYVLKR--PEYNDN-- 87
            :||.|. .|:::|  .:.|.:      ||.::|||||...::...|.|.:||..:  ..|:.|  
Yeast   165 IEDDHVEQIITIPIESEDGKSIEKDLYFFGIFDGHGGPFTSEKLSKDLVRYVAYQLGQVYDQNKT 229

  Fly    88 ---------IEQALQQGFLDIDYVML-----------RNKTCGDQM---AGSTAVVVLVKDNK-- 127
                     |:.|:.:|||.:|..::           .|....:.:   :||.|::.|.....  
Yeast   230 VFHSDPNQLIDSAISKGFLKLDNDLVIESFRKLFQDPNNTNIANTLPAISGSCALLSLYNSTNSI 294

  Fly   128 LYCANAGDSRAIAC-----VNGQLEVLSLDHKPNNEAESKRI----------IQGGGWVEFNRVN 177
            |..|..|||||:.|     .|..::.||.|...:|..|.:||          |:.|      |:.
Yeast   295 LKVAVTGDSRALICGLDNEGNWTVKSLSTDQTGDNLDEVRRIRKEHPGEPNVIRNG------RIL 353

  Fly   178 GNLALSRALGDYVFK------------------HENKKPED----QIVTAFPDVETRKIMDDWEF 220
            |:|..|||.|||.:|                  :..::|.|    ..|||.|.:.:.||.::.:|
Yeast   354 GSLQPSRAFGDYRYKIKEVDGKPLSDLPEVAKLYFRREPRDFKTPPYVTAEPVITSAKIGENTKF 418

  Fly   221 IVLACDGIWDVMSNAEV 237
            :|:..||::::::|.|:
Yeast   419 MVMGSDGLFELLTNEEI 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 72/277 (26%)
PTC5NP_014733.1 PP2C 182..464 CDD:395385 67/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.