DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and TAP38

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_194509.1 Gene:TAP38 / 828893 AraportID:AT4G27800 Length:388 Species:Arabidopsis thaliana


Alignment Length:316 Identity:90/316 - (28%)
Similarity:160/316 - (50%) Gaps:51/316 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RVGSSCMQGWRINMEDSHTHILSLPDD--PGAAFFAVYDGHGGATVAQYAGKHLHKYVLKRPEYN 85
            |.|.:.:||:|..|||.    :.:..|  ...::.||:|||.|::..::..:.|:|..:...:..
plant    59 RWGYTSVQGFRDEMEDD----IVIRSDAVDSFSYAAVFDGHAGSSSVKFLREELYKECVGALQAG 119

  Fly    86 D--------NIEQALQQGFLDIDYVMLR-NKTCGDQ--MAGSTAVVVLVKDNKLYCANAGDSRAI 139
            .        .|::||.:.|..:|..:|: .:..||:  .:||||.|::::::..:.|:.|||.|:
plant   120 SLLNGGDFAAIKEALIKAFESVDRNLLKWLEANGDEEDESGSTATVMIIRNDVSFIAHIGDSCAV 184

  Fly   140 ACVNGQLEVLSLDHKPNNEA-----ESKRIIQGGGWVEFNRVNGNLALSRALGDYVFKHEN---- 195
            ...:||:|.|:..|:|...:     |.||:.:.|||:...|:.|::|:|||.||..||.:.    
plant   185 LSRSGQIEELTDYHRPYGSSRAAIQEVKRVKEAGGWIVNGRICGDIAVSRAFGDIRFKTKKNDML 249

  Fly   196 KKPEDQ----------------IVTAFPDVETRKIMDDWEFIVLACDGIWDVMSNAEVLEFCRTR 244
            ||..|:                :|.|.||:....:..|.|||:||.||:||.|.:::|:.:.|.:
plant   250 KKGVDEGRWSEKFVSRIEFKGDMVVATPDIFQVPLTSDVEFIILASDGLWDYMKSSDVVSYVRDQ 314

  Fly   245 IGMGMFPEEICEELMNHCLAPDCQMGGLGGDNMTVVLVCLLHGR-PYSDLIARCRN 299
            :......:..||.|....|....|      ||:::::..|  || .:.:|.|:.:|
plant   315 LRKHGNVQLACESLAQVALDRRSQ------DNISIIIADL--GRTEWKNLPAQRQN 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 84/298 (28%)
TAP38NP_194509.1 PP2Cc 58..348 CDD:238083 84/298 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.