DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and DBP1

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001324148.1 Gene:DBP1 / 817102 AraportID:AT2G25620 Length:392 Species:Arabidopsis thaliana


Alignment Length:289 Identity:93/289 - (32%)
Similarity:149/289 - (51%) Gaps:23/289 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AYRVGSSCMQGWRINMEDSHTHILSLPDDPG--------AAFFAVYDGHGGATVAQYAGKHLHKY 77
            |.|.|:....|.|.:|||::..:.:..|..|        :||:.|:|||||...|::|..|:.:|
plant    87 ATRSGAWSDIGSRSSMEDAYLCVDNFMDSFGLLNSEAGPSAFYGVFDGHGGKHAAEFACHHIPRY 151

  Fly    78 VLKRPEYNDNIEQALQQGFLDIDYVMLRNKTC---GDQMAGSTAVVVLVKDNKLYCANAGDSRAI 139
            :::..|:...|.:.|...||..|...|  :.|   |...:|:||:..::....|..|||||.||:
plant   152 IVEDQEFPSEINKVLSSAFLQTDTAFL--EACSLDGSLASGTTALAAILFGRSLVVANAGDCRAV 214

  Fly   140 ACVNGQLEVLSLDHKPNNEAESKRIIQGGGWVEFNRVNGNLALSRALGDYVFKHENKKPEDQ--- 201
            ....|:...:|.||||.:..|.:||...||.|....:||.|.::|||||:..:...||.:..   
plant   215 LSRQGKAIEMSRDHKPMSSKERRRIEASGGHVFDGYLNGQLNVARALGDFHMEGMKKKKDGSDCG 279

  Fly   202 IVTAFPDVETRKIMDDWEFIVLACDGIWDVMSNAEVLEFCRTRIGMGMFPEEICEELMNHCLAPD 266
            .:.|.|::.|.|:.::.||:::.|||:|||..:...::|.|.|:.....|....:||:...|...
plant   280 PLIAEPELMTTKLTEEDEFLIIGCDGVWDVFMSQNAVDFARRRLQEHNDPVMCSKELVEEALKRK 344

  Fly   267 CQMGGLGGDNMTVVLVCLLHGRPYSDLIA 295
                  ..||:|.|:|| |..:|..:|:|
plant   345 ------SADNVTAVVVC-LQPQPPPNLVA 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 87/275 (32%)
DBP1NP_001324148.1 PLN03145 3..392 CDD:215603 93/289 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D957254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.