DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and ILKAP

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_110395.1 Gene:ILKAP / 80895 HGNCID:15566 Length:392 Species:Homo sapiens


Alignment Length:293 Identity:94/293 - (32%)
Similarity:145/293 - (49%) Gaps:51/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QGWRINMEDSHTHILSLPDD---PGA-----AFFAVYDGHGGATVAQYAGKHLHKYVLKRPEYND 86
            :|.|..|:|:|..:..:.::   |.:     ::|||:|||||...:::|.::||:.::::....|
Human   115 KGEREEMQDAHVILNDITEECRPPSSLITRVSYFAVFDGHGGIRASKFAAQNLHQNLIRKFPKGD 179

  Fly    87 --NIEQALQQGFLD----IDYVMLRNKTCGDQMA----GSTAVVVLVKDNKLYCANAGDSRAIAC 141
              ::|:.:::..||    .|...|  |....|..    ||||..||..||.||.||.||||||.|
Human   180 VISVEKTVKRCLLDTFKHTDEEFL--KQASSQKPAWKDGSTATCVLAVDNILYIANLGDSRAILC 242

  Fly   142 -VNGQLE-----VLSLDHKPNNEAESKRIIQGGGWVEFNRVNGNLALSRALGDYVFKHENKKPED 200
             .|.:.:     .||.:|.|....|..||.:.||.|...||.|.|.:||::||..:|...     
Human   243 RYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRCG----- 302

  Fly   201 QIVTAFPDVETRKIMDDWEFIVLACDGIWDVMSNAEVLEF---C------RTRIGMGMFP---EE 253
              ||:.||:...::..:..||:|||||::.|.:..|.:.|   |      :||.|.....   |.
Human   303 --VTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDEKIQTREGKSAADARYEA 365

  Fly   254 ICEELMNHCLAPDCQMGGLGGDNMTVVLVCLLH 286
            .|..|.|..:    |.|  ..||:||::|.:.|
Human   366 ACNRLANKAV----QRG--SADNVTVMVVRIGH 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 93/289 (32%)
ILKAPNP_110395.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90
PP2Cc 108..390 CDD:238083 93/289 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.