DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and ppm1lb

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001307112.1 Gene:ppm1lb / 767640 ZFINID:ZDB-GENE-060929-136 Length:348 Species:Danio rerio


Alignment Length:270 Identity:89/270 - (32%)
Similarity:137/270 - (50%) Gaps:34/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MQGWRINMEDSHTHILSLPDDPGAAFFAVYDGHGGATVAQYAGKH--------LHKYVLKRPEYN 85
            :||.|.:|||....:....:....|.|::||||||...|:||..|        |.:|  :|.:.|
Zfish    87 IQGRRDHMEDRFDILTDTRNRSHPAIFSIYDGHGGEAAAEYAKAHLPIMLRQQLQRY--ERQKEN 149

  Fly    86 DNI--EQALQQGFLDIDYVMLRNKTCGDQMAGSTAVVVLVKDNKLYCANAGDSRAIAC-VNGQLE 147
            ..:  :..|:|..|::|..:|...|.....||:|.:|.|:.:.:|..||.|||||:.| .:|...
Zfish   150 SAVSRQAILRQQILNMDREILEKLTASYDEAGTTCLVALLSEKELTVANVGDSRAVLCDKDGNAI 214

  Fly   148 VLSLDHKPNNEAESKRIIQGGGWVEFN---RVNGNLALSRALGDYVFKHENKKPEDQIVTAFPDV 209
            .||.||||....|.|||.:.||::.|:   ||.|.|::||:|||:..|.......|..:..| |:
Zfish   215 PLSHDHKPYQLKERKRIKKAGGFISFSGSWRVQGVLSMSRSLGDFPLKKLKVLIPDPDLMTF-DL 278

  Fly   210 ETRKIMDDWEFIVLACDGIWDVMSNAEVLEFCRTRIGMGMFPEE--ICEELMNHCLAPDCQMGGL 272
            :|.:.    :|::||.||:||..||.|.:.|.:.|:....|..:  :.:.....|          
Zfish   279 DTLQP----QFMILASDGLWDTFSNEEAVHFIKERLDEPHFGAKSIVLQSFYRGC---------- 329

  Fly   273 GGDNMTVVLV 282
             .||:||::|
Zfish   330 -PDNITVMVV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 89/270 (33%)
ppm1lbNP_001307112.1 PP2Cc 82..340 CDD:238083 89/270 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.