DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and Ppm1j

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_082258.2 Gene:Ppm1j / 71887 MGIID:1919137 Length:507 Species:Mus musculus


Alignment Length:314 Identity:69/314 - (21%)
Similarity:111/314 - (35%) Gaps:123/314 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 INMEDSHTHILSLPDDPGAAFF--AVYDGHGGATVAQYAGKHLHKY----------VLKRP---- 82
            ::.|.||        :.|..|:  .::|||.|...|:.|.:.||::          :||.|    
Mouse   140 VSREPSH--------NQGFCFYYWGLFDGHAGGGAAEMASRLLHRHIREQLKDLVEILKDPLPPP 196

  Fly    83 -------------------------------EYNDNIEQALQQGFLDIDYVMLRNKTCGDQMAGS 116
                                           .::..|..|::..|..:|..|.|.:.......|.
Mouse   197 LCLPSTPGTPGAPSPSQLVSPQSCWSPQKEVTHDSLIVGAIENAFHLMDEQMARERRGHQVEGGC 261

  Fly   117 TAVVVLVKDNKLYCANAGDSRAIACVNGQLEVLSLDHKPNNEAESKRII---------------- 165
            .|:|||....|:|.|||||||||...||::..:|.:..|..|.:..:::                
Mouse   262 CALVVLYLLGKMYVANAGDSRAIIVRNGEIIPMSREFTPETERQRLQLLGFLKPELLGSEFTHLE 326

  Fly   166 -------------------QGGGW----VEFN--------------RVNGNLALSRALGDYVFKH 193
                               ...||    :|..              ||...:.::|.|||:..|.
Mouse   327 FPRRVQPKELGQRMLYRDQNMTGWAYKKIEVEDLRFPLVCGEGKKARVMATIGVTRGLGDHNLKV 391

  Fly   194 ENK----KPEDQIVTAFPDVETRKIM------DDWEFIVLACDGIWDVMSNAEV 237
            .:.    ||   .::.||:|....:.      ||  .:||..||:|||.:::||
Mouse   392 CSSTLSIKP---FLSCFPEVRVYDLTQYEHCPDD--VLVLGTDGLWDVTNDSEV 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 69/314 (22%)
Ppm1jNP_082258.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..102
PP2Cc 105..499 CDD:238083 69/314 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..220 0/22 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834854
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.