DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and Tab1

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_079885.2 Gene:Tab1 / 66513 MGIID:1913763 Length:502 Species:Mus musculus


Alignment Length:318 Identity:68/318 - (21%)
Similarity:124/318 - (38%) Gaps:84/318 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QTLSEPVTAKESAYCQNAAYRVGSSCMQGWRINMEDSHTHILSLPDDPGAAF--------FAVYD 59
            |:..:|....:...|..:.  |||:..:.:..:.:.:.:|   .|:|....|        :.|::
Mouse    10 QSEQQPSWTDDLPLCHLSG--VGSASNRSYSADGKGTESH---PPEDNWLKFRSENNCFLYGVFN 69

  Fly    60 GHGGATVAQYAGKHLHKYVLKRPEYNDNIE-----------QALQQGFLD-IDYVMLRNKTCGDQ 112
            |:.|..|..:..:.|...:|......::.|           ..:::.||: ||..:....:...|
Mouse    70 GYDGNRVTNFVAQRLSAELLLGQLNTEHTEADVRRVLLQAFDVVERSFLESIDDALAEKASLQSQ 134

  Fly   113 M----------------------------AGSTAVVVLVKDNKLYCANAGDSRAIAC---VNG-Q 145
            :                            .|:.|||.::.::|||.||.|.:||:.|   |:| |
Mouse   135 LPEGVPQHQLPPQYQKILERLKALEREISGGAMAVVAVLLNSKLYVANVGTNRALLCKSTVDGLQ 199

  Fly   146 LEVLSLDHKPNNEAESKRIIQGG---GWVEFNRVNGNLALSRALGDYVFKH----------ENKK 197
            :..|::||...||.|..|:.|.|   |.::...|......:|.:|||..|:          ...|
Mouse   200 VTQLNMDHTTENEDELFRLSQLGLDAGKIKQMGVICGQESTRRIGDYKVKYGYTDIDLLSAAKSK 264

  Fly   198 PEDQIVTAFPDVETRKIMDD-WEFIVLACDGIWDVMSNAEVLEFCRTRIGMGMFPEEI 254
            |    :.|.|::...:.:|. ..|:||..:|::..:..|.         |.|...:||
Mouse   265 P----IIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAH---------GPGQANQEI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 65/299 (22%)
Tab1NP_079885.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 2/10 (20%)
PP2C 69..334 CDD:278884 57/254 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 414..476
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 1 Normalized mean entropy S7481
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.