DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and Ilkap

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_072128.2 Gene:Ilkap / 64538 RGDID:620128 Length:392 Species:Rattus norvegicus


Alignment Length:321 Identity:100/321 - (31%)
Similarity:152/321 - (47%) Gaps:53/321 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GQTLSEPVTAKESAYCQNAAYRVGSSCMQGWRINMEDSHTHILSLPDD---PGA-----AFFAVY 58
            |:.|.|....|.|:........|..  .:|.|..|:|:|..:..:..:   |.:     ::|||:
  Rat    89 GEELVEKKVCKASSVIFGLKGYVAE--RKGEREEMQDAHVILNDITQECNPPSSLITRVSYFAVF 151

  Fly    59 DGHGGATVAQYAGKHLHKYVLKRPEYND--NIEQALQQGFLD----IDYVMLRNKTCGDQMA--- 114
            |||||...:::|.::||:.::::....|  ::|:.:::..||    .|...|  |....|..   
  Rat   152 DGHGGIRASKFAAQNLHQNLIRKFPKGDVISVEKTVKRCLLDTFKHTDEEFL--KQASSQKPAWK 214

  Fly   115 -GSTAVVVLVKDNKLYCANAGDSRAIAC-VNGQLE-----VLSLDHKPNNEAESKRIIQGGGWVE 172
             ||||..||..||.||.||.||||||.| .|.:.:     .||.:|.|....|..||.:.||.|.
  Rat   215 DGSTATCVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVR 279

  Fly   173 FNRVNGNLALSRALGDYVFKHENKKPEDQIVTAFPDVETRKIMDDWEFIVLACDGIWDVMSNAEV 237
            ..||.|.|.:||::||..:|...       ||:.||:...::..:..||:|||||::.|.:..|.
  Rat   280 DGRVLGVLEVSRSIGDGQYKRCG-------VTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEA 337

  Fly   238 LEF---C------RTRIGMGMFP---EEICEELMNHCLAPDCQMGGLGGDNMTVVLVCLLH 286
            :.|   |      :||.|.....   |..|..|.|..:    |.|  ..||:||::|.:.|
  Rat   338 VNFILSCLEDEKIQTREGKPAVDARYEAACNRLANKAV----QRG--SADNVTVMVVRIGH 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 94/297 (32%)
IlkapNP_072128.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91 1/1 (100%)
PP2Cc 108..390 CDD:238083 94/298 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.