DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and ilkap

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_012825945.1 Gene:ilkap / 595059 XenbaseID:XB-GENE-1000324 Length:364 Species:Xenopus tropicalis


Alignment Length:295 Identity:96/295 - (32%)
Similarity:145/295 - (49%) Gaps:56/295 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QGWRINMEDSHTHILSL--------PDDPGAAFFAVYDGHGGATVAQYAGKHLHK-YVLKRPE-Y 84
            :|.|..::|:|| |..|        ||....::|||:|||||...:::|.::||: :|.|.|. .
 Frog    88 RGEREELQDAHT-ICDLSQDCQPMPPDLLRLSYFAVFDGHGGTRASRFAAQNLHQNFVKKIPRGE 151

  Fly    85 NDNIEQALQQGFLDI------DYVMLRNKTCGDQMA----GSTAVVVLVKDNKLYCANAGDSRAI 139
            ..::::|:::..||.      |::    |....|..    |:||:.|||.||.||.||.|||||:
 Frog   152 GSSVDKAMKRCILDAFKQTDEDFL----KQAASQKPAWKDGTTAICVLVADNILYIANLGDSRAL 212

  Fly   140 AC-VNGQLE---VLSL--DHKPNNEAESKRIIQGGGWVEFNRVNGNLALSRALGDYVFKHENKKP 198
            .| :|.:.:   ||||  :|.|....|..||.:.||.|...||.|.|.:||::||..:|...   
 Frog   213 LCRINKENQKHVVLSLSREHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKRYG--- 274

  Fly   199 EDQIVTAFPDVETRKIMDDWEFIVLACDGIWDVMSNAEVLEFCRTRIGMGMFP------------ 251
                |.:.|:|:...:.|...||:|||||::...|..|.:.|..|.......|            
 Frog   275 ----VISTPEVKRCPLTDSDRFILLACDGLFKAFSAEEAVTFILTHTQEKSSPAEDGPPDFDSLY 335

  Fly   252 EEICEELMNHCLAPDCQMGGLGGDNMTVVLVCLLH 286
            |..|..|.|..:    :.|  ..||:||::|.:.|
 Frog   336 ESACHRLANEAV----RRG--AADNVTVLIVQIQH 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 95/291 (33%)
ilkapXP_012825945.1 PP2Cc 81..362 CDD:238083 95/291 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.