DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and pdp2

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_571700.1 Gene:pdp2 / 58149 ZFINID:ZDB-GENE-000921-2 Length:530 Species:Danio rerio


Alignment Length:344 Identity:80/344 - (23%)
Similarity:111/344 - (32%) Gaps:136/344 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MEDSHTHILSLPDDPGAAFFAVYDGHGGATVAQYAGKHLHKYV------------------LKRP 82
            :||..:...||  ...:..|.|:|||||...||...:.|..|:                  ..||
Zfish   120 LEDRRSSASSL--QTRSMLFGVFDGHGGHACAQAVSERLPYYISVAMMAESVLEDLEAAMETSRP 182

  Fly    83 ------------EYN--------------------------------DNIEQALQQGFLDIDYV- 102
                        :||                                |.:..|.|:  ||.|.. 
Zfish   183 VPPILQWYKHHNDYNYRESAALYVDHLRVFWQELLASEEHGDGMRPADALSYAFQR--LDTDLSL 245

  Fly   103 ---------MLRNKTCGDQMAGSTAVVVLVKDNKLYCANAGDSRAIACV---NGQLEVLSL--DH 153
                     ::||.......||.||.|..|....::.|||||.||:..|   :|....|.|  ||
Zfish   246 EAQVPLANDLMRNTALQAAFAGCTACVAHVGPEGVHVANAGDCRAVLGVQEADGSWSALPLTKDH 310

  Fly   154 KPNNEAESKRIIQGGGW-----------VEFNRVNGNLALSRALGDYVFKHENK----------- 196
            ...|.||.:|:     |           |..:|:.|.|...||.||..||...:           
Zfish   311 NAANVAEMERV-----WRQHPASERQTVVVDDRLLGVLMPLRAFGDVRFKWSRELQQSVLENGDS 370

  Fly   197 ----------KPEDQIVTAF----PDVETRKIMDDWEFIVLACDGIWDVMSNAEVLEFCRTRIGM 247
                      .|.:.:...:    |:|...::.....|::||.||:||.|||.|.:..       
Zfish   371 DLEALNIYQYAPPNYLTPPYLEVTPEVTHHRLRPQDRFLILASDGLWDEMSNDEAVRL------- 428

  Fly   248 GMFPEEICEELMN-HCLAP 265
                  :.|.|.. |..||
Zfish   429 ------VAEHLTGVHLQAP 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 80/344 (23%)
pdp2NP_571700.1 PP2Cc 109..517 CDD:238083 80/344 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577941
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.