DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and PPM1H

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_065751.1 Gene:PPM1H / 57460 HGNCID:18583 Length:514 Species:Homo sapiens


Alignment Length:445 Identity:90/445 - (20%)
Similarity:155/445 - (34%) Gaps:181/445 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QTLSEPVTAKESAYC------QNAAYRVGSSCMQGWRINMEDSHTHILSLPDDPGAAFFAVYDGH 61
            |...|.:|.|:.|..      :|::.| .||...|..:.::::     |..:.....:::::|||
Human    95 QASCEVLTVKKKAGAVTSTPNRNSSKR-RSSLPNGEGLQLKEN-----SESEGVSCHYWSLFDGH 153

  Fly    62 GGATVAQYAGKHLHKYVLKR----------------------PE--------------------- 83
            .|:..|..|.:.|..::.::                      ||                     
Human   154 AGSGAAVVASRLLQHHITEQLQDIVDILKNSAVLPPTCLGEEPENTPANSRTLTRAASLRGGVGA 218

  Fly    84 ------------------YNDNIEQALQQGFLDIDYVMLRNKTCGDQMAGSTAVVVLVKDNKLYC 130
                              :...:..||:..|.::|..:.|.::..:...|.||::|:....|||.
Human   219 PGSPSTPPTRFFTEKKIPHECLVIGALESAFKEMDLQIERERSSYNISGGCTALIVICLLGKLYV 283

  Fly   131 ANAGDSRAIACVNGQLEVLSLDHKPNNE---------------------AESKRIIQG------- 167
            |||||||||...||::..:|.:..|..|                     .|..|.:|.       
Human   284 ANAGDSRAIIIRNGEIIPMSSEFTPETERQRLQYLAFMQPHLLGNEFTHLEFPRRVQRKELGKKM 348

  Fly   168 -------GGW---------VEF---------NRVNGNLALSRALGDYVFK-HENK---KPEDQIV 203
                   .||         ::|         .||...:.::|.|||:..| |::.   ||   .:
Human   349 LYRDFNMTGWAYKTIEDEDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVHDSNIYIKP---FL 410

  Fly   204 TAFPDVETRKI------MDDWEFIVLACDGIWDVMSNAEVLEFCRTRIGMGMFPEEICEELMNHC 262
            ::.|:|....:      .||  .::||.||:|||:||.||              .|...:.:.:|
Human   411 SSAPEVRIYDLSKYDHGSDD--VLILATDGLWDVLSNEEV--------------AEAITQFLPNC 459

  Fly   263 ----------LAPDCQMGGLG----------------GDNMTVVLVCLLHGRPYS 291
                      .|.|..|...|                ||:::|.::.|:||...|
Human   460 DPDDPHRYTLAAQDLVMRARGVLKDRGWRISNDRLGSGDDISVYVIPLIHGNKLS 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 80/411 (19%)
PPM1HNP_065751.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..135 5/26 (19%)
PP2Cc 143..507 CDD:238083 75/382 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144733
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.