DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and ppm1nb

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001096587.1 Gene:ppm1nb / 564875 ZFINID:ZDB-GENE-071004-34 Length:435 Species:Danio rerio


Alignment Length:294 Identity:105/294 - (35%)
Similarity:157/294 - (53%) Gaps:27/294 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSEPVTAK---ESAYCQNAAYRVGSSCMQGWRINMEDSHTHILSLPDDPGA----AFFAVYDGHG 62
            |..||..|   |........|.:.|  |||||.:|||.|.   ..|...|.    |||||:|||.
Zfish    59 LDRPVLDKHMQEGCASWGLTYALAS--MQGWRAHMEDFHN---CFPQLGGELSHWAFFAVFDGHA 118

  Fly    63 GATVAQYAGKHLHKYVL-----KRPEYNDNIEQALQQGFLDIDYVMLRNKTC--GDQMAGSTAVV 120
            |:.|||...::|..::|     :..|..:.:.:..::||..:| ..|....|  |.:..|:|.|.
Zfish   119 GSAVAQNCSRNLLDHILGTGKIRADEDVERVTEGFKEGFFLMD-KHLHAMACREGWERGGTTVVS 182

  Fly   121 VLVKDNKLYCANAGDSRAIACVNGQLEVLSLDHKPNNEAESKRIIQGGGWVEFNRVNGNLALSRA 185
            ..:..:.:|..|.|||||:.|..|::...:.||||.:..|.:||...||.|...||||:||:|||
Zfish   183 TAITPHHIYFVNCGDSRAVLCRAGRVAFSTEDHKPFSPGEKERIESAGGSVTLQRVNGSLAVSRA 247

  Fly   186 LGDYVFKH-ENKKPEDQIVTAFPDVETRKIMDDWEFIVLACDGIWDVMSNAEVLEFCRTRIGMGM 249
            |||:.:|. |.:...:|:|:..|:|...:.....||:||||||:||.:||.|:..|..:|:.:..
Zfish   248 LGDFSYKTVEWRSVTEQMVSPEPEVSVVERSPADEFLVLACDGVWDTVSNEELCAFVHSRLRICT 312

  Fly   250 FPEEICEELMNHCLAPDCQMGGLGGDNMTVVLVC 283
            ...|:|.::::.||    ..|.|  ||::::|||
Zfish   313 DLREVCSQVIDLCL----YKGSL--DNISIILVC 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 100/274 (36%)
ppm1nbNP_001096587.1 PP2Cc 79..341 CDD:238083 100/274 (36%)
PP2C_C 335..412 CDD:285117 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577931
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D262211at33208
OrthoFinder 1 1.000 - - FOG0000692
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.