DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and pptc7b

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_009303413.1 Gene:pptc7b / 562909 ZFINID:ZDB-GENE-081105-111 Length:297 Species:Danio rerio


Alignment Length:158 Identity:35/158 - (22%)
Similarity:63/158 - (39%) Gaps:50/158 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LQQGFLDIDYVMLRNKTCGDQMAGSTAVVVLV--KDNKLYCANAGDSRAIACVNGQLEVLSLDHK 154
            |..|:    |.:|:||.  ..:..|||.:|::  :.::::..|.|||..:....|::.     |:
Zfish   112 LTSGY----YELLQNKV--PLLGSSTACIVVLDRRSHRIHTCNLGDSGFLVVRGGEVV-----HR 165

  Fly   155 PNNEAESKRIIQGGGWVEFNRVNGNLALSRA--------LGDYVFKHENKKPEDQIVTAFPDVET 211
            .:.:.              :..|....||.|        |.|        .||....::| ||:.
Zfish   166 SDEQQ--------------HYFNTPFQLSIAPPGAEGVVLSD--------SPEAADSSSF-DVQL 207

  Fly   212 RKIMDDWEFIVLACDGIWDVMSNAEVLE 239
            ..|      |:.|.||::|.|.:..:|:
Zfish   208 GDI------ILTATDGLFDNMPDYMILQ 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 35/158 (22%)
pptc7bXP_009303413.1 PP2Cc 53..289 CDD:294085 35/158 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.