Sequence 1: | NP_647794.1 | Gene: | CG17746 / 38400 | FlyBaseID: | FBgn0035425 | Length: | 371 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001104628.1 | Gene: | pdp1 / 558728 | ZFINID: | ZDB-GENE-060810-70 | Length: | 519 | Species: | Danio rerio |
Alignment Length: | 290 | Identity: | 65/290 - (22%) |
---|---|---|---|
Similarity: | 98/290 - (33%) | Gaps: | 106/290 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 FAVYDGHGGATVAQYAGKHLHKYV----------------------------------------- 78
Fly 79 -----------------LKRPEYNDNIEQALQQGFLDIDYVMLRNKTCGDQMA------------ 114
Fly 115 GSTAVVVLVKDNKLYCANAGDSRAIACV---NGQLEVLSL--DHKPNNEAESKRI------IQGG 168
Fly 169 GWVEFNRVNGNLALSRALGDYVFK-----------------HENKKPE--------DQIVTAFPD 208
Fly 209 VETRKIMDDWEFIVLACDGIWDVMSNAEVL 238 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17746 | NP_647794.1 | PP2Cc | 22..284 | CDD:238083 | 65/290 (22%) |
pdp1 | NP_001104628.1 | PP2Cc | 96..511 | CDD:238083 | 65/290 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0631 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |