DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and ppm1j

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_684981.2 Gene:ppm1j / 556950 ZFINID:ZDB-GENE-091230-9 Length:496 Species:Danio rerio


Alignment Length:410 Identity:88/410 - (21%)
Similarity:136/410 - (33%) Gaps:153/410 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KESAYCQNAAYRVGSSCMQGWRINMEDSHTHILSLPDDPGAA--FFAVYDGHGGATVAQYAGKHL 74
            ::.|.|:....|..||..|...:.:|:|       .|..|..  |:.|:|||.|:..|..|.|.|
Zfish    96 EDQAACEVLYVRKMSSKQQRCSMLLEES-------GDTTGIPMHFWGVFDGHAGSGAALMASKLL 153

  Fly    75 HKYVLKR--------PEYN------------------------DNIEQ----------------- 90
            .:.:..|        ..:|                        |..||                 
Zfish   154 QRIIRDRLCDVAHLLENHNSPPPICLAKNGSPFQAEGKKGACLDGEEQDAGLPDEPRFHMEKDIS 218

  Fly    91 -------ALQQGFLDIDYVMLRNKTCGDQMAGSTAVVVLVKDNKLYCANAGDSRAIACVNGQLEV 148
                   .::..|..:|.::.:.|.......|..|:|.:....|||.|||||||||...|.::..
Zfish   219 VESLVMGIIETAFRQMDDLIEKEKESYSISGGCCALVAIHLMGKLYVANAGDSRAIIVRNSEVIP 283

  Fly   149 LSLDHKPNNE---------------------AESKRIIQG--------------GGW-------- 170
            :|.:..|.:|                     .|..|.||.              .||        
Zfish   284 MSTEFTPESERQRLQYLGFLKPELLGNEFTHIEFPRRIQHKELGKKMLFRDHTMTGWAYKTIIED 348

  Fly   171 -VEF---------NRVNGNLALSRALGDYVFKHENK----KPEDQIVTAFPDVETRKI------M 215
             ::|         .||...:.::|.|||:..|..|.    ||   .::..|:|:...|      .
Zfish   349 DLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVYNSNIYIKP---FLSCCPEVKVYNISEHKHGS 410

  Fly   216 DDWEFIVLACDGIWDVMSNAEVLEFCRTRIGMGMFPEEICEELMNHCLAPDCQMGGLG------- 273
            ||  .:|:..||:|||.::.:|.:...|.:.    ..|..:.|.....|.|..|...|       
Zfish   411 DD--VLVMGSDGLWDVTADRDVADAVSTFLS----SREPNDPLRYTLAAQDLLMRSRGVLKERGW 469

  Fly   274 ---------GDNMTVVLVCL 284
                     ||::||.::.|
Zfish   470 RLPNERLGSGDDITVFVIPL 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 85/398 (21%)
ppm1jXP_684981.2 PP2Cc 130..489 CDD:238083 77/367 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577945
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.