DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and ppm1f

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001018165.1 Gene:ppm1f / 553757 ZFINID:ZDB-GENE-051128-2 Length:424 Species:Danio rerio


Alignment Length:276 Identity:91/276 - (32%)
Similarity:137/276 - (49%) Gaps:36/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SC----MQGWRINMEDSH------THILSLPDDPGAAFFAVYDGHGGATVAQYAGKHLHKYVLKR 81
            ||    ::..|..|||.|      ..:|.|.|..|..::||:|||||...|.|:..|||..:.::
Zfish   140 SCSVHAIRNTRRKMEDRHVILKEFNQLLGLQDGVGREYYAVFDGHGGVDAATYSATHLHIVLSQQ 204

  Fly    82 PEYNDNIEQALQQGFLDIDYVMLRNKTCGDQM-AGSTAVVVLVKDNKLYCANAGDSRAIACVNGQ 145
            .|...:...|.:..|...| .|.:.|...::: :|||.|.||:..:.|..:..|||:|:....|:
Zfish   205 GELKTDAATAFKNTFTQTD-DMFKIKAKRERLRSGSTGVAVLLTSDLLTVSWLGDSQALLVRQGE 268

  Fly   146 LEVLSLDHKPNNEAESKRIIQGGGWVEFN---RVNGNLALSRALGDYVFKHENKKPEDQIVTAFP 207
            ...|...|||..|.|.|||...||.:.|.   ||||..|:|||:||:     ::||   .|:...
Zfish   269 PVTLMDPHKPEREDEKKRIEDLGGCIAFMGCWRVNGTYAVSRAIGDF-----DQKP---YVSNEA 325

  Fly   208 DVETRKIMDDWEFIVLACDGIWDVMSNAE----VLEFCRTRIGMGMFPEEICEELMNHCLAPDCQ 268
            |..:..:..|.::::|||||.:||:..|:    |||..|...|.|   .::.:.|:     ...:
Zfish   326 DSSSFHLTGDEDYVLLACDGFFDVIRPADVPALVLEALRESGGSG---NDVAQSLV-----AQAK 382

  Fly   269 MGGLGGDNMTVVLVCL 284
            ..| ..||:||:||.|
Zfish   383 TAG-SSDNITVLLVFL 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 90/274 (33%)
ppm1fNP_001018165.1 PP2Cc 140..397 CDD:238083 90/274 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577937
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.