DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and PPM1B

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_016859884.1 Gene:PPM1B / 5495 HGNCID:9276 Length:487 Species:Homo sapiens


Alignment Length:393 Identity:137/393 - (34%)
Similarity:206/393 - (52%) Gaps:66/393 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGQTLSEPVTAKESAYCQNAAYRVGSSCMQGWRINMEDSHTHILSLP---DDPGAAFFAVYDGHG 62
            ||..|.:|.|.|.:|:......|.|.|.|||||:.|||:||.::.:|   :|  .:||||||||.
Human     1 MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLED--WSFFAVYDGHA 63

  Fly    63 GATVAQYAGKHLHKYVLKRPEYN-------------DNIEQALQQGFLDIDYVM-----LRNKTC 109
            |:.||.|...||.:::....::.             :|::..::.|||.||..|     |||   
Human    64 GSRVANYCSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRN--- 125

  Fly   110 GDQMAGSTAVVVLVKDNKLYCANAGDSRAIACVNGQLEVLSLDHKPNNEAESKRIIQGGGWVEFN 174
            |...:|||||.|::....:|..|.|||||:...|||:...:.||||.|..|.:||...||.|...
Human   126 GMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQ 190

  Fly   175 RVNGNLALSRALGDYVFK-HENKKPEDQIVTAFPDV-ETRKIMDDWEFIVLACDGIWDVMSNAEV 237
            ||||:||:|||||||.:| .:.|.|.:|:|:..|:| |..:..:| |||:||||||||||||.|:
Human   191 RVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEILRAEED-EFIILACDGIWDVMSNEEL 254

  Fly   238 LEFCRTRIGMGMFPEEICEELMNHCLAPDCQMGGLGGDNMTVVLVCLLHGRPYSDLIARCRNGSQ 302
            .|:.::|:.:....|.:|..:::.||....:      |||::||||..:....|           
Human   255 CEYVKSRLEVSDDLENVCNWVVDTCLHKGSR------DNMSIVLVCFSNAPKVS----------- 302

  Fly   303 ATNNDQEEAGDATKDEVAKDEAEAETDTETETQ----TKPCQKQSNSGPMDDEVKMASHLNKMAA 363
                          ||..|.::|.:...|:..:    .||.:....||  ::.:...:|:.::.:
Human   303 --------------DEAVKKDSELDKHLESRVEGTFFKKPTEIMEKSG--EEGMPDLAHVMRILS 351

  Fly   364 IES 366
            .|:
Human   352 AEN 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 117/284 (41%)
PPM1BXP_016859884.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 1 1.010 - - D262211at33208
OrthoFinder 1 1.000 - - FOG0000692
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100270
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.