DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and ppm1a

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001016158.2 Gene:ppm1a / 548912 XenbaseID:XB-GENE-852654 Length:383 Species:Xenopus tropicalis


Alignment Length:297 Identity:119/297 - (40%)
Similarity:176/297 - (59%) Gaps:21/297 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGQTLSEPVTAKESAYCQNAAYRVGSSCMQGWRINMEDSHTHILSLPDDPGA-AFFAVYDGHGGA 64
            ||..|.:|...|.:|:.|....|.|.|.|||||:.|||:||.::.||:...| :||||||||.|:
 Frog     1 MGAFLDKPKMEKHNAHGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPNGLDAWSFFAVYDGHAGS 65

  Fly    65 TVAQYAGKHLHKYVLKRPEYND--------NIEQALQQGFLDIDYVM--LRNKTCGDQMAGSTAV 119
            .||:|..:||..::....::..        :::..::.|||.||..|  :..|..|...:|||||
 Frog    66 QVAKYCCEHLLDHITSNQDFKGTDGHLSVWSVKNGIRTGFLQIDEHMRVISEKKHGADRSGSTAV 130

  Fly   120 VVLVKDNKLYCANAGDSRAIACVNGQLEVLSLDHKPNNEAESKRIIQGGGWVEFNRVNGNLALSR 184
            .|:...|.:|..|.||||.:.|.:.::...:.||||:|..|.:||...||.|...||||:||:||
 Frog   131 GVMTSPNHIYFINCGDSRGLLCRSKKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSR 195

  Fly   185 ALGDYVFK--HENKKPEDQIVTAFPDV-ETRKIMDDWEFIVLACDGIWDVMSNAEVLEFCRTRIG 246
            ||||:.:|  | .|.|.:|:|:..|:| |..:..:|.:||:||||||||||.|.|:.:|..:|:.
 Frog   196 ALGDFDYKCVH-GKGPTEQLVSPEPEVYEIERSEEDDQFIILACDGIWDVMGNEELCDFVWSRLE 259

  Fly   247 MGMFPEEICEELMNHCLAPDCQMGGLGGDNMTVVLVC 283
            :....|.:|.|:::.||....:      |||:|:|:|
 Frog   260 VTDDLERVCNEIVDTCLYKGSR------DNMSVILIC 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 112/276 (41%)
ppm1aNP_001016158.2 PP2C 22..284 CDD:366121 107/268 (40%)
PP2C_C 285..361 CDD:369544 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D262211at33208
OrthoFinder 1 1.000 - - FOG0000692
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.