DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and Pdp1

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_006237970.1 Gene:Pdp1 / 54705 RGDID:620393 Length:578 Species:Rattus norvegicus


Alignment Length:387 Identity:86/387 - (22%)
Similarity:127/387 - (32%) Gaps:157/387 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VYDGHGGATVAQYAGKHLHKYVL-----------------------------KRPEYND------ 86
            |:|||.|...:|...:.|..|:.                             |.|  ||      
  Rat   182 VFDGHAGCACSQAVSERLFYYIAVSLLPHETLLEIENAVESGRALLPILQWHKHP--NDYFSKEA 244

  Fly    87 --------------------------NIEQALQQGFLDIDYVMLRNKTCGD------------QM 113
                                      ::::||...|..:|..:......||            ..
  Rat   245 SKLYFNSLRTYWQELIDLNTGESADIDVKEALINAFKRLDNDISLEAQVGDPNSFLNYLVLRVAF 309

  Fly   114 AGSTAVVVLVKDNKLYCANAGDSRAIACV----------------NGQ----LEVLSLDHKPNNE 158
            :|:||.|..|....|:.||.|||||:..|                |.|    ||.|.|:| |.||
  Rat   310 SGATACVAHVDGVDLHVANTGDSRAMLGVQEEDGSWSAVTLSNDHNAQNERELERLKLEH-PKNE 373

  Fly   159 AESKRIIQGGGWVEFNRVNGNLALSRALGDYVF-------KHENKKPEDQI-------------- 202
            |:|.        |:.:|:.|.|...||.||..|       |...:...||:              
  Rat   374 AKSV--------VKQDRLLGLLMPFRAFGDVKFKWSIDLQKRVIESGPDQLNDNEYTKFIPPNYH 430

  Fly   203 ----VTAFPDVETRKIMDDWEFIVLACDGIWDVMSNAEVLEFCRTRIGMGMFPEEICEEL--MNH 261
                :||.|:|...::....:|:|||.||:|:.|...:|:..             :.|.|  |:|
  Rat   431 TPPYLTAEPEVTYHRLRPQDKFLVLATDGLWETMHRQDVVRI-------------VGEYLTGMHH 482

  Fly   262 CLAPDCQMGGLGGDNMTVVLVCLLHGRPYSDLIARCRNGSQATNNDQEEAGDATKDEVAKDE 323
                 .|...:||..:|   :..:||     |:...|....:...||..|....:..|..:|
  Rat   483 -----QQPIAVGGYKVT---LGQMHG-----LLTERRAKMSSVFEDQNAATHLIRHAVGNNE 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 77/346 (22%)
Pdp1XP_006237970.1 PP2Cc 149..565 CDD:238083 86/387 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.