DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and PDP1

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_016869077.1 Gene:PDP1 / 54704 HGNCID:9279 Length:591 Species:Homo sapiens


Alignment Length:378 Identity:82/378 - (21%)
Similarity:125/378 - (33%) Gaps:139/378 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VYDGHGGATVAQYAGKHLHKYVL-----------------------------KRPEYND------ 86
            |:|||.|...:|...:.|..|:.                             |.|  ||      
Human   196 VFDGHAGCACSQAVSERLFYYIAVSLLPHETLLEIENAVESGRALLPILQWHKHP--NDYFSKEA 258

  Fly    87 --------------------------NIEQALQQGFLDIDYVMLRNKTCGD------------QM 113
                                      ::::||...|..:|..:......||            ..
Human   259 SKLYFNSLRTYWQELIDLNTGESTDIDVKEALINAFKRLDNDISLEAQVGDPNSFLNYLVLRVAF 323

  Fly   114 AGSTAVVVLVKDNKLYCANAGDSRAIACVNGQ-----LEVLSLDHKPNNEAESKRI------IQG 167
            :|:||.|..|....|:.||.|||||:..|..:     ...||.||...||.|.:|:      .:.
Human   324 SGATACVAHVDGVDLHVANTGDSRAMLGVQEEDGSWSAVTLSNDHNAQNERELERLKLEHPKSEA 388

  Fly   168 GGWVEFNRVNGNLALSRALGDYVF-------KHENKKPEDQI------------------VTAFP 207
            ...|:.:|:.|.|...||.||..|       |...:...||:                  :||.|
Human   389 KSVVKQDRLLGLLMPFRAFGDVKFKWSIDLQKRVIESGPDQLNDNEYTKFIPPNYHTPPYLTAEP 453

  Fly   208 DVETRKIMDDWEFIVLACDGIWDVMSNAEVLEFCRTRIGMGMFPEEICEEL--MNHCLAPDCQMG 270
            :|...::....:|:|||.||:|:.|...:|:..             :.|.|  |:|     .|..
Human   454 EVTYHRLRPQDKFLVLATDGLWETMHRQDVVRI-------------VGEYLTGMHH-----QQPI 500

  Fly   271 GLGGDNMTVVLVCLLHGRPYSDLIARCRNGSQATNNDQEEAGDATKDEVAKDE 323
            .:||..:|   :..:||     |:...|....:...||..|....:..|..:|
Human   501 AVGGYKVT---LGQMHG-----LLTERRTKMSSVFEDQNAATHLIRHAVGNNE 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 73/337 (22%)
PDP1XP_016869077.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.