DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and Ppm1d

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_058606.3 Gene:Ppm1d / 53892 MGIID:1858214 Length:598 Species:Mus musculus


Alignment Length:365 Identity:87/365 - (23%)
Similarity:150/365 - (41%) Gaps:96/365 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGQTLSEPVTAKESAYCQNAAYRVGSSCMQGWRINMEDSHTHILSLPDDPGAAFFAVYDGHGGAT 65
            :|.:...|..|::.|....|:...|..|.:                  ....|||||.|||||..
Mouse    58 VGPSEKGPAAARDPAPDAAASLPAGRCCRR------------------RSSVAFFAVCDGHGGRE 104

  Fly    66 VAQYAGKHLHKYVLKRPEYNDN----IEQALQQGFLDIDYVMLRN-----KTCG--DQMAGSTAV 119
            .||:|.:||..::.|:..:..:    :..|:::|||.....|.:.     ||..  ...:|:||.
Mouse   105 AAQFAREHLWGFIKKQKGFTSSEPAKVCAAIRKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTAS 169

  Fly   120 VVLVKDNKLYCANAGDSRAIACVNGQ--------LEVLSLDHKPNNEAESKRIIQGGGWVEFNRV 176
            ||:::..|:|.|:.|||..:..:...        :|| :.||||....|.:| |:|.|....|:.
Mouse   170 VVIIRGMKMYVAHVGDSGVVLGIQDDPKDDFVRAVEV-TQDHKPELPKERER-IEGLGGSVMNKS 232

  Fly   177 NGN--------------------------LALSRALGDYVFKHE--------NKKPEDQIVTAFP 207
            ..|                          ||::||||| ::.::        :.:|:..:.|..|
Mouse   233 GVNRVVWKRPRLTHSGPVRRSTVIDQIPFLAVARALGD-LWSYDFFSGKFVVSPEPDTSVHTLDP 296

  Fly   208 DVETRKIMDDWEFIVLACDGIWDVMSNAEVLEFCR----TRIGMGMFPEEICEELMNHCLAPDCQ 268
                ||    .::|:|..||:|:::...:.:..|:    .:..||...:...:.|:|..|. ..:
Mouse   297 ----RK----HKYIILGSDGLWNMVPPQDAISMCQDQEEKKYLMGEQGQSCAKMLVNRALG-RWR 352

  Fly   269 MGGLGGDNMTVVLVCLLHGRPYSDLIARCRNGSQATNNDQ 308
            ...|..||.:.:::|:   .|..|      |....||.|:
Mouse   353 QRMLRADNTSAIVICI---SPEVD------NQGNFTNEDE 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 75/318 (24%)
Ppm1dNP_058606.3 Interaction with CHEK1. /evidence=ECO:0000250 1..94 8/53 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..74 4/15 (27%)
PP2C 84..361 CDD:278884 73/306 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..419
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 509..584
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.