DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and ppm1kb

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001314673.1 Gene:ppm1kb / 503713 ZFINID:ZDB-GENE-050306-8 Length:372 Species:Danio rerio


Alignment Length:274 Identity:86/274 - (31%)
Similarity:139/274 - (50%) Gaps:37/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RVGSSCMQGWRINMEDSHTHILSLPDDPGAAFFAVYDGHGGATVAQYAGKHLHKYVLKRPEYNDN 87
            ||||:...|.|...||.: .:..:.|:  ..:|||:||||||..|.:..|::.|::........|
Zfish    94 RVGSASQIGQRKENEDRY-QMSQMTDN--IMYFAVFDGHGGAEAADFCHKNMEKHIKDIAAEETN 155

  Fly    88 IEQALQQGFLDIDYVMLR----NKTCGDQMAGSTAVVVLVKDN-KLYCANAGDSRAIACVNGQLE 147
            :|..|.:.||::|..:.|    :.......||:||.|.|::|. :|...:.|||||:.|..|:..
Zfish   156 LEFVLTKAFLEVDKALARHLHFSADASVLSAGTTATVALLRDGIELVVGSVGDSRAMMCRKGKAV 220

  Fly   148 VLSLDHKPNNEAESKRIIQGGGWVEFN-----RVNGNLALSRALGDYVFKHENKKPEDQIVTAFP 207
            .|::||.|..:.|.:||.:.||::.:|     .|||.||::|::||:..|...       |.|.|
Zfish   221 KLTVDHTPERKDEKERIRRSGGFITWNSLGQPHVNGRLAMTRSIGDFDLKATG-------VIAEP 278

  Fly   208 DVETRKI----MDDWEFIVLACDGIWDVMSNAEVLEFCRTRIGMGMFPEEICEELMNHCLAPDCQ 268
              ||::|    :.| .|:.|..|||..:|::.|:.:.    |.....|:|..:.:....|    |
Zfish   279 --ETKRISLHHVHD-SFLALTTDGINFIMNSQEICDV----INQCHDPKEAAQRISEQAL----Q 332

  Fly   269 MGGLGGDNMTVVLV 282
            .|  ..||.|:::|
Zfish   333 YG--SEDNSTIIVV 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 86/274 (31%)
ppm1kbNP_001314673.1 PP2Cc 94..346 CDD:238083 86/274 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.