DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and pptc7a

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001007379.1 Gene:pptc7a / 492506 ZFINID:ZDB-GENE-041114-74 Length:297 Species:Danio rerio


Alignment Length:282 Identity:60/282 - (21%)
Similarity:100/282 - (35%) Gaps:93/282 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DDPGAAFFA---------VYDGHG-----GATVAQYAGKHLH---------KYVLKRPEYNDNIE 89
            ||  |.|.|         |.||.|     |...:|::|..:.         ::|...|       
Zfish    53 DD--ACFIARHRSADVLGVADGVGGWRDYGVDPSQFSGTLMRTCERLVKEGRFVPSNP------- 108

  Fly    90 QALQQGFLDIDYV-MLRNKTCGDQMAGSTAVVVLV--KDNKLYCANAGDSRAIACVNGQLEVLSL 151
                .|.|...|. :|:||.  ..:..|||.:|::  :.::|:.||.|||..:....|::.    
Zfish   109 ----VGILTTSYYELLQNKV--PLLGSSTACIVVLDRQSHRLHTANLGDSGFLVVRGGEVV---- 163

  Fly   152 DHKPNNEAESKRIIQGGGWVEFNRVNGNLALSRALGDYVFKHENKKPEDQIVTAFPDVETRKIMD 216
             |:.:.:.              :..|....||.|         ..:.|..:::..||.......|
Zfish   164 -HRSDEQQ--------------HYFNTPFQLSIA---------PPEAEGSVLSDSPDAADSSSFD 204

  Fly   217 D--WEFIVLACDGIWDVMSNAEVLEFCRTRIGMG-----MFPEEICEELMNHCLAPD-------- 266
            .  .:.|:.|.||::|.|.:..:|:..:......     ...:.|.|:.  |.||.|        
Zfish   205 VQLGDIILTATDGLFDNMPDYMILQELKKLKNTNYESTQQTAKSIAEQA--HVLAYDPNYMSPFA 267

  Fly   267 ---CQMG----GLGGDNMTVVL 281
               |..|    |...|::||:|
Zfish   268 QFACDNGLNVRGGKPDDITVLL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 60/282 (21%)
pptc7aNP_001007379.1 PP2Cc 53..289 CDD:381813 59/280 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.