DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and ppm1j

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001005797.1 Gene:ppm1j / 448275 XenbaseID:XB-GENE-941439 Length:257 Species:Xenopus tropicalis


Alignment Length:198 Identity:48/198 - (24%)
Similarity:76/198 - (38%) Gaps:67/198 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QTLSEPVTAKESAYCQNAAYRVGSSC--MQGWRINMEDSHTHILSLPDDPGAAFF--AVYDGHGG 63
            |...|.||.::    |||.:   |.|  :|..:|...:.   .||..|| |.:|:  .::|||.|
 Frog    68 QACCEFVTVEK----QNAKF---SDCKELQDLKIVQGEK---CLSQEDD-GLSFYYWGLFDGHAG 121

  Fly    64 ATVAQYAGK--HLH-----------------------------------------------KYVL 79
            ...|..|.:  |||                                               ::.|
 Frog   122 CGCAIAASRLLHLHICDHLRDLVHILPHSAAAPLSLDPGNRIDHMAGIKSLENAQAPEVAVRFHL 186

  Fly    80 KRPEYNDN-IEQALQQGFLDIDYVMLRNKTCGDQMAGSTAVVVLVKDNKLYCANAGDSR--AIAC 141
            ::..:.:: :..|::..|.::|..:.|.:|......|..|:|.:....|||.|||||||  .:..
 Frog   187 EKQVFPESLVIGAIENAFKEMDEQIKRERTTYKIEGGCCALVAVYLLGKLYVANAGDSRYAVLVS 251

  Fly   142 VNG 144
            |||
 Frog   252 VNG 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 41/179 (23%)
ppm1jNP_001005797.1 PP2Cc 106..>253 CDD:320769 31/147 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.