Sequence 1: | NP_647794.1 | Gene: | CG17746 / 38400 | FlyBaseID: | FBgn0035425 | Length: | 371 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001005797.1 | Gene: | ppm1j / 448275 | XenbaseID: | XB-GENE-941439 | Length: | 257 | Species: | Xenopus tropicalis |
Alignment Length: | 198 | Identity: | 48/198 - (24%) |
---|---|---|---|
Similarity: | 76/198 - (38%) | Gaps: | 67/198 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 QTLSEPVTAKESAYCQNAAYRVGSSC--MQGWRINMEDSHTHILSLPDDPGAAFF--AVYDGHGG 63
Fly 64 ATVAQYAGK--HLH-----------------------------------------------KYVL 79
Fly 80 KRPEYNDN-IEQALQQGFLDIDYVMLRNKTCGDQMAGSTAVVVLVKDNKLYCANAGDSR--AIAC 141
Fly 142 VNG 144 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17746 | NP_647794.1 | PP2Cc | 22..284 | CDD:238083 | 41/179 (23%) |
ppm1j | NP_001005797.1 | PP2Cc | 106..>253 | CDD:320769 | 31/147 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |