DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and fig

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_651724.1 Gene:fig / 43511 FlyBaseID:FBgn0039694 Length:314 Species:Drosophila melanogaster


Alignment Length:270 Identity:61/270 - (22%)
Similarity:98/270 - (36%) Gaps:79/270 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PGAAFFAVYDGHG-----GATVAQYAGKHLHKYVLKRPEYND----NIEQALQQGFLDIDYVMLR 105
            |.|....|.||.|     |....::| |.|......:.:.:|    :....|..||.::.:   |
  Fly    78 PLAEVMGVADGVGGWRDLGVDAGRFA-KELMSCCSGQTQLSDFDGRSPRNMLIAGFQELSH---R 138

  Fly   106 NKTCGDQMAGSTAVVVLV--KDNKLYCANAGDSRAIACVNGQLEVLSLDHKPNNEAESKRIIQGG 168
            ....   :..|||.:..:  ||..||.||.|||..:...||:  ||   |:...:..        
  Fly   139 EHPV---VGSSTACLATMHRKDCTLYTANLGDSGFLVVRNGR--VL---HRSVEQTH-------- 187

  Fly   169 GWVEFNRVNGNLALSRALGDYVFKHENKKPEDQIVTAFPD-----VETRKIMDDWEFIVLACDGI 228
               :||.            .|..   ...|||:..:.:.|     |.||..:...:.::||.||:
  Fly   188 ---DFNT------------PYQL---TVPPEDRKESYYCDKPEMAVSTRHSLLPGDLVLLATDGL 234

  Fly   229 WDVMSNA---EVLEFCRTR------IGMGMFPEEICEELMN-------------HCLAPDCQMGG 271
            :|.|..:   .:|...:.|      :|.....|:..|..||             |.::   ..||
  Fly   235 FDNMPESMLLSILNGLKERGEHDLLVGASRVVEKARELSMNASFQSPFAIKARQHNVS---YSGG 296

  Fly   272 LGGDNMTVVL 281
            ...|::|::|
  Fly   297 GKPDDITLIL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 61/270 (23%)
figNP_651724.1 PP2Cc 68..306 CDD:294085 60/268 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.