DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and CG6036

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_651472.2 Gene:CG6036 / 43185 FlyBaseID:FBgn0039421 Length:371 Species:Drosophila melanogaster


Alignment Length:336 Identity:127/336 - (37%)
Similarity:188/336 - (55%) Gaps:22/336 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGQTLSEPVTAKESAYCQNAAYRVGSSCMQGWRINMEDSHTHILSLPDDPGA--AFFAVYDGHGG 63
            ||..|.:|.|.|::........|...|.|||||:.|||||:....| .||.|  ::|||:|||.|
  Fly     5 MGGFLEKPETEKQAQEGHGNGLRYCVSSMQGWRLEMEDSHSAACRL-KDPFATWSYFAVFDGHAG 68

  Fly    64 ATVAQYAGKHLHKYVLKRPEYNDN-IEQALQQGFLDIDYVMLRNKTCGDQMAGSTAVVVLVKDNK 127
            :.::.:..:||...:|:...::.: .|..:::|||.:|..|  .|...||..||||:.|.|..:|
  Fly    69 SQISLHCAEHLMSTILESESFSKHKYEAGIREGFLQLDEDM--RKLYHDQQGGSTAICVFVSPDK 131

  Fly   128 LYCANAGDSRAIACVNGQLEVLSLDHKPNNEAESKRIIQGGGWVEFNRVNGNLALSRALGDYVFK 192
            :|..|.|||||:...||...:.::||||.:..|.:||...||.|...|:||.||:|||.|||.||
  Fly   132 IYLVNCGDSRAVISRNGAAVISTIDHKPFSPKEQERIQNAGGSVMIKRINGTLAVSRAFGDYDFK 196

  Fly   193 HE-NKKPEDQIVTAFPDVETRKIMDDWEFIVLACDGIWDVMSNAEVLEFCRTRIGMGMFPEEICE 256
            :: :|.|.||:|:..||:......:..||||:|||||||||:::||.||.|:|:.:......|..
  Fly   197 NDGSKSPVDQMVSPEPDIIVCNRSEHDEFIVVACDGIWDVMTSSEVCEFIRSRLLVTYDLPMIVN 261

  Fly   257 ELMNHCLAPDCQMGGLGGDNMTVVLVCLLHGRPYSDLIARCRNGSQATNNDQEEAGDATKDEVAK 321
            .:::.||....:      ||||::|: ||.|.|..|:     :..:|..:..:.....||:.:.|
  Fly   262 SVLDICLHKGSR------DNMTLLLL-LLPGAPKVDM-----DAVKAERSLDQTIVQITKEVIEK 314

  Fly   322 DEAEAETDTET 332
            .|..   |.||
  Fly   315 HEIH---DFET 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 108/265 (41%)
CG6036NP_651472.2 PP2Cc 27..277 CDD:238083 105/258 (41%)
PP2C_C 284..352 CDD:285117 11/47 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438656
Domainoid 1 1.000 147 1.000 Domainoid score I1447
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D262211at33208
OrthoFinder 1 1.000 - - FOG0000692
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100270
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.