DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and CG12091

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001261261.1 Gene:CG12091 / 38177 FlyBaseID:FBgn0035228 Length:321 Species:Drosophila melanogaster


Alignment Length:200 Identity:42/200 - (21%)
Similarity:72/200 - (36%) Gaps:67/200 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 MAGSTAVVVLV--KDNKLYCANAGDSRAIACVNGQLEVLSLDHKPNNEAESKRIIQGGGWVEFNR 175
            :..|||.|:::  :.:.::.||.|||..:....||:.     ||...:.              :.
  Fly   153 LGSSTACVLILNRETSTVHTANIGDSGFVVVREGQVV-----HKSEEQQ--------------HY 198

  Fly   176 VNGNLALS--------RALGDYVFKHENKKPEDQIVTAFPDVETRKIMDDWEFIVLACDGIWD-- 230
            .|....||        ..|.|        .||.....:||       :.|.:.|::|.||::|  
  Fly   199 FNTPFQLSLPPPGHGPNVLSD--------SPESADTMSFP-------VRDGDVILIATDGVFDNV 248

  Fly   231 -------VMSNAE----VLEFCRTRIGMGMFPEEICEELMNHCLAP--------DCQMGGLGGDN 276
                   |:|..|    .::...|...:.:....:  .|.:..|:|        :.|..|...|:
  Fly   249 PEDLMLQVLSEVEGERDPVKLQMTANSLALMARTL--SLNSEFLSPFALSARRNNIQARGGKPDD 311

  Fly   277 MTVVL 281
            :||||
  Fly   312 ITVVL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 41/199 (21%)
CG12091NP_001261261.1 PP2Cc 76..316 CDD:294085 40/198 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.