DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and CG10376

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_609899.1 Gene:CG10376 / 35126 FlyBaseID:FBgn0032702 Length:428 Species:Drosophila melanogaster


Alignment Length:258 Identity:76/258 - (29%)
Similarity:116/258 - (44%) Gaps:50/258 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DPGAAFFAVYDGHGGATVAQYAGKHLHKYVLKRPEYN--------DNIEQALQQGFLDIDYVMLR 105
            |....||.|:|||.|:..|.||...|.:.:..:.:.|        |....|.:..||..|....:
  Fly   190 DKTTRFFGVFDGHSGSLSATYATSQLPQLLADQLKANPDPAAFSPDFYRNAFESAFLLADERFTQ 254

  Fly   106 NKTCGDQMAGSTAVVVLVKDNKLYCANAGDSRAIAC-VNGQLEVLSLDHKPNNEAESKRIIQGGG 169
            .|.    .:|:|:|..|:..::||.|..|||:|:.. ...||:::. .|||.|..|.|||...||
  Fly   255 KKI----TSGTTSVCALITKDQLYIAWVGDSKALLVGKRTQLQLVK-PHKPENPDERKRIETAGG 314

  Fly   170 --------WVEFNRVNGNLALSRALGDYVFKHENKKPEDQIVTAFPDVETRKIMDDWEFIVLACD 226
                    |    ||||.|.::|::|||..:....:|:      |.||:..:..|   |:||..|
  Fly   315 TVLHAQGQW----RVNGILNVARSIGDYSLEAVIAEPD------FVDVQLNEAHD---FLVLGTD 366

  Fly   227 GIWDVMSNAEVLE-----FCRTRIGMGMFPEEICEELMNHCLAPDCQMGGLGGDNMTVVLVCL 284
            |:||.:..:.::|     ...|.:.:...|:.:.|.....    |.|      ||:|.|:|.|
  Fly   367 GLWDHVPESLIIETVYDSLADTTMKLDDIPKLLIEAAKER----DSQ------DNITAVVVLL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 75/256 (29%)
CG10376NP_609899.1 PP2Cc 160..419 CDD:238083 75/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445093
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13832
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.