DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and PPM1J

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_005158.5 Gene:PPM1J / 333926 HGNCID:20785 Length:505 Species:Homo sapiens


Alignment Length:345 Identity:70/345 - (20%)
Similarity:121/345 - (35%) Gaps:126/345 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SEPVTAKESAYCQNAAYRVGSSCMQGWRINMEDSHTHILSLPDDP----GAAFF--AVYDGHGGA 64
            :|.:.|.:|.:.::.|      |.:   :...:....:..:|.:|    |..|:  .::|||.|.
Human   108 AEVINAGKSRHNEDQA------CCE---VVYVEGRRSVTGVPREPSRGQGLCFYYWGLFDGHAGG 163

  Fly    65 TVAQYAGKHLHKYVLKRPEYNDNIE---------------------------------------- 89
            ..|:.|.:.||:::  |.:..|.:|                                        
Human   164 GAAEMASRLLHRHI--REQLKDLVEILQDPSPPPLCLPTTPGTPDSSDPSHLLGPQSCWSSQKEV 226

  Fly    90 -------QALQQGFLDIDYVMLRNKTCGDQMAGSTAVVVLVKDNKLYCANAGDSRAIACVNGQLE 147
                   .|::..|..:|..|.|.:.......|..|:||:....|:|.|||||||||...||::.
Human   227 SHESLVVGAVENAFQLMDEQMARERRGHQVEGGCCALVVIYLLGKVYVANAGDSRAIIVRNGEII 291

  Fly   148 VLSLDHKPNNEAESKRII-----------------------------------QGGGW----VEF 173
            .:|.:..|..|.:..:::                                   ...||    :|.
Human   292 PMSREFTPETERQRLQLLGFLKPELLGSEFTHLEFPRRVLPKELGQRMLYRDQNMTGWAYKKIEL 356

  Fly   174 N--------------RVNGNLALSRALGDYVFK-HENKKPEDQIVTAFPDVETRKIM------DD 217
            .              ||...:.::|.|||:..| ..:..|....::.||:|....:.      ||
Human   357 EDLRFPLVCGEGKKARVMATIGVTRGLGDHSLKVCSSTLPIKPFLSCFPEVRVYDLTQYEHCPDD 421

  Fly   218 WEFIVLACDGIWDVMSNAEV 237
              .:||..||:|||.::.||
Human   422 --VLVLGTDGLWDVTTDCEV 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 66/329 (20%)
PPM1JNP_005158.5 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..103
PP2Cc 106..498 CDD:238083 70/345 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144742
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.