DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17746 and Ppm1h

DIOPT Version :9

Sequence 1:NP_647794.1 Gene:CG17746 / 38400 FlyBaseID:FBgn0035425 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001103688.1 Gene:Ppm1h / 319468 MGIID:2442087 Length:513 Species:Mus musculus


Alignment Length:446 Identity:91/446 - (20%)
Similarity:155/446 - (34%) Gaps:184/446 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QTLSEPVTAKESAYC------QNAAYRVGSSCMQGWRINM-EDSHTHILSLPDDPGAAFFAVYDG 60
            |...|.:|.|:.|..      :|:..|  ||...|..:.: |:|.:..:|      ..:::::||
Mouse    95 QASCEVLTVKKKAGTITSTPNRNSKRR--SSLPNGEGLQLKENSESEGIS------CHYWSLFDG 151

  Fly    61 HGGATVAQYAGKHLHKYVLKR--------------------------PEYNDNIEQ--------- 90
            |.|:..|..|.:.|..::.::                          |.:...:.:         
Mouse   152 HAGSGAAVVASRLLQHHITQQLQDIVEILKNSAILPPTCLGEEPESTPAHGRTLTRAASLRGGVG 216

  Fly    91 --------------------------ALQQGFLDIDYVMLRNKTCGDQMAGSTAVVVLVKDNKLY 129
                                      ||:..|.::|..:.|.::..:...|.||::|:....|||
Mouse   217 APGSPSTPPTRFFTEKKIPHECLVIGALESAFKEMDLQIERERSAYNISGGCTALIVVCLLGKLY 281

  Fly   130 CANAGDSRAIACVNGQLEVLSLDHKPNNE---------------------AESKRIIQG------ 167
            .|||||||||...||::..:|.:..|..|                     .|..|.:|.      
Mouse   282 VANAGDSRAIIIRNGEIIPMSSEFTPETERQRLQYLAFMQPHLLGNEFTHLEFPRRVQRKELGKK 346

  Fly   168 --------GGW---------VEF---------NRVNGNLALSRALGDYVFK-HENK---KPEDQI 202
                    .||         ::|         .||...:.::|.|||:..| |::.   ||   .
Mouse   347 MLYRDFNMTGWAYKTIEDDDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVHDSNIYIKP---F 408

  Fly   203 VTAFPDVETRKI------MDDWEFIVLACDGIWDVMSNAEVLEFCRTRIGMGMFPEEICEELMNH 261
            :::.|:|....:      .||  .::||.||:|||:||.||              .|...:.:.:
Mouse   409 LSSAPEVRVYDLSRYEHGADD--VLILATDGLWDVLSNEEV--------------AEAITQFLPN 457

  Fly   262 C----------LAPDCQMGGLG----------------GDNMTVVLVCLLHGRPYS 291
            |          .|.|..|...|                ||:::|.::.|:||...|
Mouse   458 CDPDDPHRYTLAAQDLVMRARGVLKDRGWRISNDRLGSGDDISVYVIPLIHGNKLS 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17746NP_647794.1 PP2Cc 22..284 CDD:238083 81/412 (20%)
Ppm1hNP_001103688.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..133 5/25 (20%)
PP2Cc 142..506 CDD:238083 75/388 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834845
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.